DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32176 and Caap1

DIOPT Version :8

Sequence 1:NP_730271.1 Gene:CG32176 / 39944 FlyBaseID:FBgn0052176 Length:581 Species:Drosophila melanogaster
Sequence 2:XP_006238462.1 Gene:Caap1 / 500501 RGDID:1560251 Length:358 Species:Rattus norvegicus

Alignment Length:411 Identity:85/412 (21%)
Similarity:141/412 (34%) Gaps:168/412 (41%)


  Fly    20 SIKKEKIEEER------------KLHPMSHYIDDRLELVKQIFGTLKPKTILNLAPEFLKKTPLD 72
            |::||.|..|.            .|.|:|.||.|:.|:::|.|..:..:.:..:.|:.||...::
  Rat    89 SLEKELILAEHSDLEEGGLDLTVSLKPVSFYISDKKEMLQQCFCIIGEQKLQKMLPDVLKNCSVE 153

  Fly    73 EIEELCLEELLCLSTKRLKSIIENTKCPTDTESSEDSDVEHKEEH--------ISLEEISSDSDI 129
            ||::||.|:|..||.|::..|:|.       ::..|||:|.:.:.        ||.::...||  
  Rat   154 EIKKLCQEQLELLSEKKILKILEG-------DNGLDSDMEEEADRGSKVAPDLISQQDTCVDS-- 209

  Fly   130 GGQESRKTKKKLRSKKTNNGNENKESGGQMSVLELLELQARARAIRSQLAMEPITKIEVKSDDDI 194
                    ...||..|...|.|:|:..|:.|  ::|.:.|.|                  .|.||
  Rat   210 --------TSSLRENKQPEGLESKQGKGEDS--DVLSINADA------------------YDSDI 246

  Fly   195 DEVPVEKVQRKEKDKRSTKKTDSSKRKSQESARPTSPSQPDSSSKEQEAPRKRIKIKRNYRRTSK 259
            :                                  .||..::::....||               
  Rat   247 E----------------------------------GPSNEEAAASATAAP--------------- 262

  Fly   260 SPEKEVKPPTSTTSSETLVASNDLNKLPRSKSRSASPDVIP---IQTEPETLLISDSTDDEATKK 321
                          :.|.||:            :||...:|   :|:|...:      ||     
  Rat   263 --------------TATAVAT------------AASASEVPGGTVQSEAAQI------DD----- 290

  Fly   322 KTTETTTTKQVESDPPAPVVESEPEE--GEVRDEPEEPAKVVDPANPDEPTESEAAAISKELESN 384
                      :|.|     :|....|  |.|...|:||...:....|.|..:..|    ::||..
  Rat   291 ----------LERD-----IEKSVNEILGLVESSPKEPKAAILTVPPPEDVQPSA----QQLELL 336

  Fly   385 KPEVSDTSDK-LDKTGDKEPP 404
            :.|:...:.| |.|.||.:.|
  Rat   337 ELEMRARAIKALMKAGDIKKP 357

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32176NP_730271.1 CAAP1 33..94 CDD:291980 21/61 (34%)
SPATA3 199..>296 CDD:292290 9/97 (9%)
Caap1XP_006238462.1 CAAP1 114..175 CDD:291980 21/61 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C177623080
eggNOG 1 0.900 E1_29F4A
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR14740
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
43.890

Return to query results.
Submit another query.