DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32176 and F15D4.2

DIOPT Version :8

Sequence 1:NP_730271.1 Gene:CG32176 / 39944 FlyBaseID:FBgn0052176 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_496803.1 Gene:F15D4.2 / 174966 WormBaseID:WBGene00008859 Length:183 Species:Caenorhabditis elegans

Alignment Length:213 Identity:44/213 - (20%)
Similarity:81/213 - (38%) Gaps:63/213 - (29%)


  Fly    32 LHPMSHYIDDRLELVKQIFGTLKPKTILNLAPEFLKKTPLDEIEELCLEELLCLSTKRLKSIIEN 96
            |..:||::|....|.:.....::.:.:..|.|..|:....:::::|.|.|:..:|.|||.:::..
 Worm    12 LASLSHFVDHTDLLAEHTMNAVEWEAVEVLMPRILRGKSKEDVKQLLLAEIDGMSKKRLDAVLAG 76

  Fly    97 TKCPTDTESSEDSDVEHKEEHISLEEISSDSDIGGQ-ESRKTKKKLRSKKTNNGNENKESGGQMS 160
                   |:.|:|.....||    |::     ||.. ||.|::..                    
 Worm    77 -------ETLEESSSSEDEE----EQV-----IGSAGESEKSESP-------------------- 105

  Fly   161 VLELLELQAR--ARAIRSQLAMEPITKIEVKSDDDIDEVPVEKVQRKEKDKRSTKKTDSSKRKSQ 223
              |:.|.:|:  .:|:.:..|.|       .|||..::..:      ..|:.:|..|...     
 Worm   106 --EIPEPEAKMEEQAVEAAEASE-------ASDDGREDGEI------RDDQGNTTSTPPD----- 150

  Fly   224 ESARPTSPSQPDSSSKEQ 241
                |.||..|:....||
 Worm   151 ----PGSPKSPEKGEAEQ 164

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG32176NP_730271.1 CAAP1 33..94 CDD:291980 14/60 (23%)
SPATA3 199..>296 CDD:292290 9/43 (21%)
F15D4.2NP_496803.1 CAAP1 14..74 CDD:291980 14/59 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C177611015
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR14740
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.