DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: frc and VRG4

Sequence 1:NP_001137962.1 Gene:frc FlyBaseID:FBgn0042641 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_011290.1 Gene:VRG4 SGDID:S000003193 Length:337 Species:Saccharomyces cerevisiae

Alignment Length:325 Identity:75/326 (23%)
Similarity:144/326 (44%) Gaps:48/326 (15%)


  Fly    66 SALFYGLSSFMITVVNKTVLTSYHF-PSFLFLSLGQLTASIV-----VLGMGKRLKLVNFPPLQR 124
            |.|.|..||.::||.||.|:....| .:|:.|.:..|..:|.     :||..|      |..|.:
Yeast    24 SILSYCGSSILMTVTNKFVVNLKDFNMNFVMLFVQSLVCTITLIILRILGYAK------FRSLNK 82

  Fly   125 NTFAKIFPLPLIFLGNMMFGLGGTKTLSLPMFAALRRFSILMTMLLELKILGLRPSNAVQVSVYA 189
            ......||:..:.:..:.......:.|::|::...:..:|::....|:...|...::....|...
Yeast    83 TDAKNWFPISFLLVLMIYTSSKALQYLAVPIYTIFKNLTIILIAYGEVLFFGGSVTSMELSSFLL 147

  Fly   190 MIGGALLAASDD-------------------LSFNMRGYIYVMITNALTASNGVYV-KKKLDTSE 234
            |:..:::|...|                   .||| .||.: |.||.:|::..|.: :|::..:.
Yeast   148 MVLSSVVATWGDQQAVAAKAASLAEGAAGAVASFN-PGYFW-MFTNCITSALFVLIMRKRIKLTN 210

  Fly   235 IGKYGLMYYNSLFMFLPALAL------NYVTGNLDQALNFEQWNDSVFVVQFLLSCVMGFILSYS 293
            ...:..|:||:: :.||.|.|      ::.:.||..  ||.  |||  :...::|.|....:||.
Yeast   211 FKDFDTMFYNNV-LALPILLLFSFCVEDWSSVNLTN--NFS--NDS--LTAMIISGVASVGISYC 268

  Fly   294 TILCTQFNSALTTTIVGCLKNICVTYLGMFIGGDYVFSWLNCIGINISVLASLLYTYVTFRRKRA 358
            :..|.:..|:.|.::||.|..:.:...|: |..|...::|:.:.|.|..|:.::|.....::::|
Yeast   269 SGWCVRVTSSTTYSMVGALNKLPIALSGL-IFFDAPRNFLSILSIFIGFLSGIIYAVAKQKKQQA 332

  Fly   359  358
            Yeast   333  332

Known Domains:


GeneSequenceDomainRegion External IDIdentity
frcNP_001137962.1 TPT 67..348 CDD:281186 72/313 (23%)
VRG4NP_011290.1 VRG4 15..337 CDD:227402 75/326 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C118207090
eggNOG 1 0.900 E1_COG5070
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I1758
Isobase 1 0.950 0 Normalized mean entropy S1931
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T1136091
orthoMCL 1 0.900 OOG5_127495
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R503
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.