DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: frc and Slc35d2

Sequence 1:NP_001137962.1 Gene:frc FlyBaseID:FBgn0042641 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_001001321.2 Gene:Slc35d2 MGIID:1917734 Length:326 Species:Mus musculus

Alignment Length:304 Identity:142/305 (47%)
Similarity:214/305 (70%) Gaps:3/305 (1%)


  Fly    66 SALFYGLSSFMITVVNKTVLTSYHFPSFLFLSLGQLTASIVVLGMGKRLKLVNFPPLQRNTFAKI 130
            ||||||..||:|.:|||.:||:|.|||.:.|.:||:..:|::|.:.|..|:::||...:....|:
Mouse    18 SALFYGTCSFLIVLVNKALLTTYGFPSPIVLGIGQMATTIMILYVFKLNKIIHFPDFDKKIPGKL 82

  Fly   131 FPLPLIFLGNMMFGLGGTKTLSLPMFAALRRFSILMTMLLELKILGLRPSNAVQVSVYAMIGGAL 195
            |||||:::||.:.||..|..||||||..||:|:|..|:|||..|||.:.|..:.:||.|::.||.
Mouse    83 FPLPLLYVGNHISGLSSTSKLSLPMFTVLRKFTIPFTLLLEAIILGTQYSLNIILSVLAIVLGAF 147

  Fly   196 LAASDDLSFNMRGYIYVMITNALTASNGVYVKKKLDTSEIGKYGLMYYNSLFMFLPALALNYVTG 260
            :||..||:||:.|||:|.:.:..||:||||.|:|:|..|:||||:::||:.||.:|.:.::..||
Mouse   148 IAAGSDLTFNLEGYIFVFLNDIFTAANGVYTKQKMDPKELGKYGVLFYNACFMLIPTVIISVSTG 212

  Fly   261 NLDQALNFEQWNDSVFVVQFLLSCVMGFILSYSTILCTQFNSALTTTIVGCLKNICVTYLGMFIG 325
            :..||..|..|.:.:|::||||||::||:|.|||.||:.:||||||.:||.:||:.|.|:||.:|
Mouse   213 DFQQATEFRHWKNVLFIIQFLLSCLLGFLLMYSTALCSYYNSALTTAVVGAIKNVSVAYIGMLVG 277

  Fly   326 GDYVFSWLNCIGINISVLASLLYTYVTFR---RKRAPDKQDHLP 366
            |||:||.||.||:||.:...|.|:::|..   :.:.|..::.:|
Mouse   278 GDYIFSLLNFIGLNICMAGGLRYSFLTLSSQLKPKQPVDEESIP 321

Known Domains:


GeneSequenceDomainRegion External IDIdentity
frcNP_001137962.1 TPT 67..348 CDD:281186 137/281 (49%)
Slc35d2NP_001001321.2 TPT 16..301 CDD:281186 139/283 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C118186504
eggNOG 1 0.900 E1_COG5070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001743
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127495
Panther 1 1.100 O PTHR11132
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R503
TreeFam 1 0.960
87.730

Return to query results.
Submit another query.