DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: frc and tmem241

Sequence 1:NP_001137962.1 Gene:frc FlyBaseID:FBgn0042641 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_001016467.1 Gene:tmem241 XenbaseID:XB-GENE-971853 Length:132 Species:Xenopus tropicalis

Alignment Length:67 Identity:20/68 (29%)
Similarity:29/68 (43%) Gaps:14/68 (21%)


  Fly    45 GSKELSHREREDSALFVKKIGSALFYG--------LSSFMI----TVVNKTVLTSYHFPSFLFLS 97
            |..|:::..|.|..:::.  |.|||.|        ||...|    |:.|...:.||.|...||..
 Frog    57 GWLEINYNSRSDVVVWLP--GCALFVGIIYAGSRALSRLSIPVFFTLHNAAEVVSYGFQRLLFRE 119

  Fly    98 LG 99
            :|
 Frog   120 VG 121

Known Domains:


GeneSequenceDomainRegion External IDIdentity
frcNP_001137962.1 TPT 67..348 CDD:281186 15/46 (33%)
tmem241NP_001016467.1 VRG4 5..>121 CDD:227402 19/66 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C118208737
eggNOG 1 0.900 E1_COG5070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R503
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.