DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: frc and AT4G32272

Sequence 1:NP_001137962.1 Gene:frc FlyBaseID:FBgn0042641 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_001190887.1 Gene:AT4G32272 AraportID:AT4G32272 Length:359 Species:Arabidopsis thaliana

Alignment Length:350 Identity:101/350 (29%)
Similarity:169/350 (48%) Gaps:23/350 (7%)


  Fly    15 PLLAESDVGNRELEEKMGGSADRSSLLDGSG-SKELSHREREDSALFVKKIGSALFYGL-SSFMI 77
            ||..|:|...:.::::         |..||. :|..::......|..|.......|.|. ||||:
plant    13 PLAGENDSDGKGVDDR---------LFKGSAMTKRGAYAALSYMACAVLVFSRIRFSGFRSSFML 68

  Fly    78 TVVNKTVLTSYHFPSFLFLSLGQLTASIVVLGMGKRLKLVNFPPL------QRNTFAKI------ 130
            .:.||..|:||.||....::|.|:.:|.:.|...:|.|:::|...      ..:||..:      
plant    69 VLFNKAALSSYDFPCVNVITLFQMVSSSLFLYALRRRKIISFTAADSFSIDSASTFVPVKTLFHT 133

  Fly   131 FPLPLIFLGNMMFGLGGTKTLSLPMFAALRRFSILMTMLLELKILGLRPSNAVQVSVYAMIGGAL 195
            .||.:.:|..|:..:...:.:::||:..|||.::..||::|..:.|.|.:.::..||..::.||.
plant   134 LPLAIAYLLYMLASMASVRGVNVPMYTTLRRTTVAFTMVIEYMLTGQRYTRSIIGSVGIILLGAF 198

  Fly   196 LAASDDLSFNMRGYIYVMITNALTASNGVYVKKKLDTSEIGKYGLMYYNSLFMFLPALALNYVTG 260
            .|.:.||||:..||..|.:.|..||.....:.:...:|.:..:|||:.|.:......:...::.|
plant   199 FAGARDLSFDFYGYGVVFLANISTAVYLATIARTGKSSGLNSFGLMWSNGIICGPILMIWTFICG 263

  Fly   261 NLDQALNFEQWNDSVFVVQFLLSCVMGFILSYSTILCTQFNSALTTTIVGCLKNICVTYLGMFIG 325
            :|::.:||.......|:|..|.|||:.|:|:|...|.|..|||||.||.|.:|::....||..:.
plant   264 DLEKTINFPHLLTPGFMVVLLCSCVLAFVLNYCIFLNTTLNSALTQTICGNMKDLFTVGLGWMLF 328

  Fly   326 GDYVFSWLNCIGINISVLASLLYTY 350
            |...|..:|.||.......|.||.|
plant   329 GGLPFDLMNVIGQLFGFFGSGLYAY 353

Known Domains:


GeneSequenceDomainRegion External IDIdentity
frcNP_001137962.1 TPT 67..348 CDD:281186 89/294 (30%)
AT4G32272NP_001190887.1 VRG4 64..355 CDD:227402 89/290 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H22870
Inparanoid 1 1.050 144 1.000 Inparanoid score I1714
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T125002
orthoMCL 1 0.900 OOG5_127495
Panther 1 1.100 LDO PTHR11132
Phylome 1 0.910 0.640 Consistency score
87.970

Return to query results.
Submit another query.