DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: frc and slc35d1a

Sequence 1:NP_001137962.1 Gene:frc FlyBaseID:FBgn0042641 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_001003877.1 Gene:slc35d1a ZFINID:ZDB-GENE-040826-5 Length:336 Species:Danio rerio

Alignment Length:310 Identity:168/311 (54%)
Similarity:240/311 (77%) Gaps:0/311 (0%)


  Fly    55 EDSALFVKKIGSALFYGLSSFMITVVNKTVLTSYHFPSFLFLSLGQLTASIVVLGMGKRLKLVNF 119
            |.:...:.|:.:|.|||:|||:|.||||:|||:|.|||.:.:.:||:.|::|||.:||.|:::.|
Zfish    15 EQTLTVLLKLSAAGFYGISSFLIVVVNKSVLTNYRFPSSICVGIGQMLATVVVLRVGKALRVITF 79

  Fly   120 PPLQRNTFAKIFPLPLIFLGNMMFGLGGTKTLSLPMFAALRRFSILMTMLLELKILGLRPSNAVQ 184
            |....:...|.|||||:::||.:.||.|||.|:||||..|||||||.|||.|..:|..:.|..||
Zfish    80 PEFDGSIPRKTFPLPLLYVGNQITGLFGTKRLNLPMFTVLRRFSILFTMLAEGFLLKKKFSRPVQ 144

  Fly   185 VSVYAMIGGALLAASDDLSFNMRGYIYVMITNALTASNGVYVKKKLDTSEIGKYGLMYYNSLFMF 249
            ::|:.||.||.:|||.||:|:::||:::::.:.|||:||.:||:|||:.|:|||||:|||:|||.
Zfish   145 LTVFTMILGAFVAASADLAFDLQGYVFILMNDVLTAANGAFVKQKLDSKELGKYGLLYYNALFMI 209

  Fly   250 LPALALNYVTGNLDQALNFEQWNDSVFVVQFLLSCVMGFILSYSTILCTQFNSALTTTIVGCLKN 314
            ||.|.|.:|||::|:|.:::.|:|.:|:.||.|||:|||||.|||:||||:||||||||||||||
Zfish   210 LPTLLLAHVTGDMDKAFDYDGWSDVLFISQFFLSCIMGFILMYSTVLCTQYNSALTTTIVGCLKN 274

  Fly   315 ICVTYLGMFIGGDYVFSWLNCIGINISVLASLLYTYVTFRRKRAPDKQDH 364
            |.|||:||..||||:|||.|.||:|||:..||:|:|:||..::...:.::
Zfish   275 ILVTYIGMVFGGDYIFSWTNFIGLNISIAGSLVYSYITFTEEQITKQSEN 324

Known Domains:


GeneSequenceDomainRegion External IDIdentity
frcNP_001137962.1 TPT 67..348 CDD:281186 162/281 (58%)
slc35d1aNP_001003877.1 VRG4 30..310 CDD:227402 161/280 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5070
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H22870
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001743
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127495
Panther 1 1.100 LDO PTHR11132
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
87.780

Return to query results.
Submit another query.