DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: frc and Tmem241

Sequence 1:NP_001137962.1 Gene:frc FlyBaseID:FBgn0042641 Length:373 Species:Drosophila melanogaster
Sequence 2:XP_006526114.1 Gene:Tmem241 MGIID:2442435 Length:374 Species:Mus musculus

Alignment Length:267 Identity:62/268 (23%)
Similarity:106/268 (40%) Gaps:55/268 (21%)


  Fly   107 VLGMGKRLKLVNFPPLQRNTFAKIF-PLPLIFLGNMMFGLGGTKTLSLPMFAALRRFSILMTMLL 170
            |||:     |:..|.|...:...|: |...:|:|.:..|......|::|:|..|...:.::|...
Mouse   103 VLGI-----LLRSPSLHIRSDVLIWLPASALFVGIIYAGSKALSRLAVPVFFILHNVAEVLTCGY 162

  Fly   171 ELKILGLRPSNAVQVSVYAMIGGALLAASDDLSFNMRGYIYVMITNALTASNGVYVKKKLDT--S 233
            :..:...:.|.:...|...::..|......|..|:..||.:.:|......|..:..|.:..|  |
Mouse   163 QKCVWKEKTSLSKICSALFLLAAAGCLPFQDSQFDPDGYFWALIHIFCVGSYKILRKSRKPTVLS 227

  Fly   234 EIGKYGLMYYNSLF-MFLPALALNYVTGNLDQALNFEQWNDSVFVVQFLLSC----VMGFILSYS 293
            :|.:   .|.|.:| |.|.|.| ::.||:|..||:|    ..::..:|..||    |:||.|..|
Mouse   228 DIDQ---QYLNYIFSMVLLAFA-SHPTGDLFGALDF----PFLYFYRFHGSCCASGVLGFFLMLS 284

  Fly   294 T---------------ILCTQFNSALTTTIVGCLKNICVTYLGMFIGGDYVFSWLNCIGINISVL 343
            |               |||.:.:.:|...            ||:.:.|       ..:|:..|..
Mouse   285 TVRLRSILAPGQCAAWILCAKVSPSLEEA------------LGVSVTG-------GLLGLLPSTR 330

  Fly   344 ASLLYTY 350
            ...:|:|
Mouse   331 IVRIYSY 337

Known Domains:


GeneSequenceDomainRegion External IDIdentity
frcNP_001137962.1 TPT 67..348 CDD:281186 60/264 (23%)
Tmem241XP_006526114.1 VRG4 104..>243 CDD:227402 33/147 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C118208829
eggNOG 1 0.900 E1_COG5070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R503
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.