DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: frc and Slc35d2

Sequence 1:NP_001137962.1 Gene:frc FlyBaseID:FBgn0042641 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_001099568.2 Gene:Slc35d2 RGDID:1309518 Length:326 Species:Rattus norvegicus

Alignment Length:320 Identity:147/321 (46%)
Similarity:222/321 (69%) Gaps:6/321 (2%)


  Fly    53 EREDSALFVKKIG---SALFYGLSSFMITVVNKTVLTSYHFPSFLFLSLGQLTASIVVLGMGKRL 114
            |..|:|....::.   ||||||..||:|.:|||.:||:|.|||.:.|.:||:|.:|::|.:.|..
  Rat     2 EEPDAARLPSRLARLLSALFYGTCSFLIVLVNKALLTTYGFPSPIVLGIGQMTTTIMILYVSKLN 66

  Fly   115 KLVNFPPLQRNTFAKIFPLPLIFLGNMMFGLGGTKTLSLPMFAALRRFSILMTMLLELKILGLRP 179
            |:::||...:....|:|||||:::||.:.||..|..||||||..||:|:|.:|:|||..|||.:.
  Rat    67 KIIHFPDFDKKIPGKLFPLPLLYVGNHISGLSSTSKLSLPMFTVLRKFTIPLTLLLEAIILGKQY 131

  Fly   180 SNAVQVSVYAMIGGALLAASDDLSFNMRGYIYVMITNALTASNGVYVKKKLDTSEIGKYGLMYYN 244
            |.::.:||.|::.||.:||..||:||..||::|.:.:..||:||||.|:|:|..|:||||:::||
  Rat   132 SLSIILSVLAIVLGAFIAAGSDLTFNWEGYVFVFLNDIFTAANGVYTKQKMDPKELGKYGVLFYN 196

  Fly   245 SLFMFLPALALNYVTGNLDQALNFEQWNDSVFVVQFLLSCVMGFILSYSTILCTQFNSALTTTIV 309
            :.||.:|.:.::..||:..||..|..|.:.:|:|||||||::||:|.|||.||:.:||||||.:|
  Rat   197 ACFMLIPTVIISVSTGDFQQATEFSHWKNVLFIVQFLLSCLLGFLLMYSTALCSYYNSALTTAVV 261

  Fly   310 GCLKNICVTYLGMFIGGDYVFSWLNCIGINISVLASLLYTYVTF---RRKRAPDKQDHLP 366
            |.:||:.|.|:||.:||||:||.||.||:||.:...|.|:::|.   .:.:.|..::.||
  Rat   262 GAIKNVSVAYIGMLVGGDYIFSLLNFIGLNICMAGGLRYSFLTLSSQSKPKQPVDEESLP 321

Known Domains:


GeneSequenceDomainRegion External IDIdentity
frcNP_001137962.1 TPT 67..348 CDD:281186 138/281 (49%)
Slc35d2NP_001099568.2 TPT 16..301 CDD:281186 140/285 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C118187191
eggNOG 1 0.900 E1_COG5070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001743
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127495
Panther 1 1.100 O PTHR11132
Phylome 1 0.910 0.800 Consistency score
TreeFam 1 0.960
76.700

Return to query results.
Submit another query.