DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: frc and Slc35d1

Sequence 1:NP_001137962.1 Gene:frc FlyBaseID:FBgn0042641 Length:373 Species:Drosophila melanogaster
Sequence 2:XP_006503142.1 Gene:Slc35d1 MGIID:2140361 Length:389 Species:Mus musculus

Alignment Length:305 Identity:168/306 (55%)
Similarity:229/306 (75%) Gaps:9/306 (3%)


  Fly    46 SKELSHREREDSAL--------FVKKIGSALFYGLSSFMITVVNKTVLTSYHFPSFLFLSLGQLT 102
            :|..:||:.|:..:        |:|.: :|.|||:|||:|.||||:|||:|.|||.|.:.|||:.
Mouse    18 AKSSTHRDEEELGMAPAETLTVFLKLL-AAGFYGVSSFLIVVVNKSVLTNYRFPSSLCVGLGQMV 81

  Fly   103 ASIVVLGMGKRLKLVNFPPLQRNTFAKIFPLPLIFLGNMMFGLGGTKTLSLPMFAALRRFSILMT 167
            |::.||.:||.|::|.||...||...|.|||||::.||.:.||..||.|:||||..|||||||.|
Mouse    82 ATVAVLWVGKTLRVVKFPDFDRNVPRKTFPLPLLYFGNQITGLFSTKKLNLPMFTVLRRFSILFT 146

  Fly   168 MLLELKILGLRPSNAVQVSVYAMIGGALLAASDDLSFNMRGYIYVMITNALTASNGVYVKKKLDT 232
            |..|..:|....|..::::|:|||.||.:|||.||:|::.||::::|.:.|||:||.|||:|||:
Mouse   147 MFAEGALLKKTFSWGIKMTVFAMIIGAFVAASSDLAFDLEGYVFILINDVLTAANGAYVKQKLDS 211

  Fly   233 SEIGKYGLMYYNSLFMFLPALALNYVTGNLDQALNFEQWNDSVFVVQFLLSCVMGFILSYSTILC 297
            .|:|||||:|||:|||.||.||:.|.||:..:|:.||.|.|::|::||.|||||||||.|:|:||
Mouse   212 KELGKYGLLYYNALFMILPTLAIAYFTGDAQKAMEFEGWADTLFLLQFTLSCVMGFILMYATVLC 276

  Fly   298 TQFNSALTTTIVGCLKNICVTYLGMFIGGDYVFSWLNCIGINISV 342
            ||:|||||||||||:|||.:||:||..||||:|:|.|.||:||||
Mouse   277 TQYNSALTTTIVGCIKNILITYIGMVFGGDYIFTWTNFIGLNISV 321

Known Domains:


GeneSequenceDomainRegion External IDIdentity
frcNP_001137962.1 TPT 67..348 CDD:281186 162/277 (58%)
Slc35d1XP_006503142.1 VRG4 49..303 CDD:227402 147/254 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5070
Hieranoid 1 1.000
Homologene 1 1.000 H22870
Inparanoid 1 1.050 360 1.000 Inparanoid score I2189
Isobase 1 0.950 0 Normalized mean entropy S1931
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001743
OrthoInspector 1 1.000 T1083540
orthoMCL 1 0.900 OOG5_127495
Panther 1 1.100 LDO PTHR11132
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R503
TreeFam 1 0.960
1312.810

Return to query results.
Submit another query.