DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: frc and bus-12

Sequence 1:NP_001137962.1 Gene:frc FlyBaseID:FBgn0042641 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_001040957.1 Gene:bus-12 WormBaseID:WBGene00010442 Length:315 Species:Caenorhabditis elegans

Alignment Length:314 Identity:66/315 (21%)
Similarity:139/315 (44%) Gaps:33/315 (10%)


  Fly    66 SALFYGLSSFMITVVNKTVLTSYHFPSFLFLSLGQLTASIVVLGMGKRLKLVNFPPLQRNTFAK- 129
            |.:.:..:|...::::|.::|.|.|...:.:.:.|..|::.|:.:.:.|.::...|.   .|.| 
 Worm    11 SMIVFVAASVFCSLMSKIMVTRYFFDYPVVILMMQSAATLFVIEVTRVLGILKVAPY---CFEKG 72

  Fly   130 ---IFPLPLIFLGNMMFGLGGTKTLSLPMFAALRRFSILMTMLLELKILGL----RPSNAVQVSV 187
               :.| .:::..:....:...:.:::|.|.:::|.:.:      |.::||    |.....|...
 Worm    73 RHIVIP-SILYTISQWITVASFEGIAMPNFDSVKRLTPI------LILVGLAARNRQQRVDQNKT 130

  Fly   188 YAMIG---GALLAASDDLSFNMRGYIYVMITNALTASNGVYVKKKLDTSEIGKYGLMY-YNSLFM 248
            :.:||   .:..|.:.|||.:....:|.::...|.|:..|..::.|......:...|: :|||..
 Worm   131 FIIIGLSIASAFAVNLDLSVDRYSLMYGLVGAILQAAAFVLFEEHLQNYNYTEVLYMHSFNSLVF 195

  Fly   249 FLPALALNYVTGNLDQALNFEQWN-DSVFVVQFLLSCVMGFILSYSTILCTQFNSALTTTIVGCL 312
            :|.|   :.|...|..|..:...: ..:|::.|.:|...|.:..::|..|.:.|..|...||..:
 Worm   196 YLLA---DMVRDELRDAFMYMITSAHPLFIIVFAVSMFAGVLFHFTTFSCLEKNGPLNMQIVSNV 257

  Fly   313 KNICVTYLGMFIGGDYVFSWLNCIGINISVLASLLYTYVTFRRKRAPDKQDHLP 366
            :.:..|:|..:: ..|:|..:....:|.:.||      |||...||...:|..|
 Worm   258 RAVVETFLAYYL-SVYLFYDVYPGVLNWAFLA------VTFVAARALVNRDCEP 304

Known Domains:


GeneSequenceDomainRegion External IDIdentity
frcNP_001137962.1 TPT 67..348 CDD:281186 58/294 (20%)
bus-12NP_001040957.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.