DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: frc and slc35d2

Sequence 1:NP_001137962.1 Gene:frc FlyBaseID:FBgn0042641 Length:373 Species:Drosophila melanogaster
Sequence 2:XP_003199083.2 Gene:slc35d2 ZFINID:ZDB-GENE-080125-1 Length:330 Species:Danio rerio

Alignment Length:290 Identity:149/291 (51%)
Similarity:209/291 (72%) Gaps:0/291 (0%)


  Fly    63 KIGSALFYGLSSFMITVVNKTVLTSYHFPSFLFLSLGQLTASIVVLGMGKRLKLVNFPPLQRNTF 127
            |..||.||...||:|.|:||::||.|.||||:||.:||:.|:|::|...|..|.::|....|:..
Zfish    14 KFLSATFYAFCSFLIIVINKSILTEYKFPSFMFLGIGQMAATIIILYAAKMNKTIHFQDFDRSIV 78

  Fly   128 AKIFPLPLIFLGNMMFGLGGTKTLSLPMFAALRRFSILMTMLLELKILGLRPSNAVQVSVYAMIG 192
            .|||||||:::||.:.||||||.||||||..||:|:||:||::|.:||....:..:..||.|::.
Zfish    79 GKIFPLPLLYVGNHVTGLGGTKKLSLPMFTVLRKFTILLTMIMESRILKKSFAPPLVCSVLAIVL 143

  Fly   193 GALLAASDDLSFNMRGYIYVMITNALTASNGVYVKKKLDTSEIGKYGLMYYNSLFMFLPALALNY 257
            |||:|||.|||||..||.:|::.:..||::|||.||||....:||||:::||:..:.:|.:..:.
Zfish   144 GALIAASSDLSFNAEGYTFVLMNDVFTAASGVYTKKKLGMEGLGKYGVLFYNAFIIIIPTVLASA 208

  Fly   258 VTGNLDQALNFEQWNDSVFVVQFLLSCVMGFILSYSTILCTQFNSALTTTIVGCLKNICVTYLGM 322
            .||:|.:||.:|.|....|:..|||||||||||.||.|||:.:|:|||||:||.:||..|.|:||
Zfish   209 YTGDLQKALTYEGWLSFTFIFYFLLSCVMGFILMYSIILCSYYNTALTTTVVGAIKNAGVMYIGM 273

  Fly   323 FIGGDYVFSWLNCIGINISVLASLLYTYVT 352
            |:||||:|||.|.||:||.:.|.|:|:|:|
Zfish   274 FVGGDYIFSWPNFIGLNICISAGLVYSYIT 303

Known Domains:


GeneSequenceDomainRegion External IDIdentity
frcNP_001137962.1 TPT 67..348 CDD:281186 144/281 (51%)
slc35d2XP_003199083.2 VRG4 16..301 CDD:227402 146/285 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C118181033
eggNOG 1 0.900 E1_COG5070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001743
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11132
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
54.890

Return to query results.
Submit another query.