DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: frc and slc35d3

Sequence 1:NP_001137962.1 Gene:frc FlyBaseID:FBgn0042641 Length:373 Species:Drosophila melanogaster
Sequence 2:XP_002936313.2 Gene:slc35d3 XenbaseID:XB-GENE-6067133 Length:421 Species:Xenopus tropicalis

Alignment Length:332 Identity:91/333 (27%)
Similarity:163/333 (49%) Gaps:27/333 (8%)


  Fly    64 IGSALFYGLSSFMITVVNKTVLTSYHFPSFLFLSLGQLTASI---VVLGMGKRLKLVNFPPLQRN 125
            |..|:.:|:.|..:.::.|.:::.|||.   ||:|.|...||   |.|.:.:|...::.||... 
 Frog    11 ISVAIAHGIFSGSLNILLKFLVSRYHFS---FLTLVQCALSITAAVTLEVLRRCGKISVPPYSL- 71

  Fly   126 TFAKIF-PLPLIFLGNMMFGLGGTKTLSLPMFAALRRFSILMTMLLELKIL--GLRPSNAVQVSV 187
            :.|:|| .:.::........|...:.|||||:...:|...|.|:|:.:.:|  || ||..|.::|
 Frog    72 SLARIFAAVTILCTLQATLTLWSLRGLSLPMYVVFKRCLPLFTLLIGVLVLRNGL-PSIGVVIAV 135

  Fly   188 YAMIGGALLAASDDLSFNMRGYIYVMITNALTASNGVYVKKKLDTSEIGKYGLMYYNSLFMFLPA 252
            :....||.||.:.|||....|||..::...:.::..|.::|....||.|.....|..|:......
 Frog   136 FITTCGAALAGAGDLSGEPVGYITGVMAVIVHSAYLVIIQKTSTDSEHGPLTAQYVISVTQTPLL 200

  Fly   253 LALNYVTGNLDQALNFEQWNDSVFVVQFLLSCVMGFILSYSTILCTQFNSALTTTIVGCLKNICV 317
            :..::::.::..|.:|..|.|.|.|..|:...::|..::::|:.||..|||:||:.||.:|:|..
 Frog   201 IVFSFISMDMINAWSFPGWKDPVMVCLFIFCTLIGCAMNFTTLHCTYINSAVTTSFVGVVKSIVT 265

  Fly   318 TYLGMFIGGDYVFSWLNCIGINISVLASLLY---TYVTFRR-------KRAPDKQDHL------P 366
            ..:||....|...:.|...|:.::.:.|::|   .|...||       ::...|:|::      |
 Frog   266 ITVGMLAFTDVAPTSLFIAGVVVNTVGSIIYCVAKYFEIRRQINYEDLEKETSKEDNIELGGDHP 330

  Fly   367 STRGENV 373
            ....||:
 Frog   331 PFAMENI 337

Known Domains:


GeneSequenceDomainRegion External IDIdentity
frcNP_001137962.1 TPT 67..348 CDD:281186 81/287 (28%)
slc35d3XP_002936313.2 VRG4 29..307 CDD:227402 82/283 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.