DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tap and Neurog3

Sequence 1:NP_524124.1 Gene:tap FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_067732.1 Gene:Neurog3 RGDID:631350 Length:214 Species:Rattus norvegicus

Alignment Length:255 Identity:84/256 (33%)
Similarity:107/256 (42%) Gaps:66/256 (26%)


  Fly    57 PQPYSGGTWDAVPLSSPPAGFVGLLD--TSSNHSTRSGRTLVEHLNSRATNGVFDPPLTSTPVKS 119
            |.|....|......:..|  |.|..|  ..|::||....|||....|.|..|  |...||..:::
  Rat     3 PHPLDAPTIQVSQETQQP--FPGASDHEVLSSNSTPPSPTLVPRDCSEAEAG--DCRGTSRKLRA 63

  Fly   120 PEDPNAPRPKRKYAVGKNRVTRSRSPTQVVKIKRFRRMKANDRERNRMHNLNDALEKLRVTLPSL 184
            ... ...|||.:.|:.|.|              |.||.||||||||||||||.||:.||..||:.
  Rat    64 RRG-GRNRPKSELALSKQR--------------RSRRKKANDRERNRMHNLNSALDALRGVLPTF 113

  Fly   185 PEETKLTKIEILRFAHNYIFALEQVLESGGSINLDLEKLQNFTLSGERITKELFDALFVNPQP-- 247
            |::.||||||.||||||||:||.|.|                         .:.|..|..|:|  
  Rat   114 PDDAKLTKIETLRFAHNYIWALTQTL-------------------------RIADHSFYGPEPPV 153

  Fly   248 ------YPLFGRMFPYGQGMAPLAQ-HQTAPASHAEQPPAMGGFQHGMDYPQQP----PG 296
                  .|..|....:|...:|::| ...:|.:..|:.|       |:..|..|    ||
  Rat   154 PCGELGSPGGGSSGDWGSIYSPVSQAGSLSPTASLEEFP-------GLQVPSSPSCLLPG 206

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tapNP_524124.1 HLH 155..207 CDD:278439 39/52 (75%)
Neurog3NP_067732.1 HLH 81..140 CDD:238036 43/98 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C119975128
eggNOG 1 0.900 E1_KOG3898
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001315
OrthoInspector 1 1.000 T617605
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR19290
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
76.890

Return to query results.
Submit another query.