DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tap and Neurod6

Sequence 1:NP_524124.1 Gene:tap FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001102707.1 Gene:Neurod6 RGDID:1562793 Length:337 Species:Rattus norvegicus

Alignment Length:268 Identity:81/269 (30%)
Similarity:117/269 (43%) Gaps:50/269 (19%)


  Fly   118 KSPEDPNAPRPKRKYAVGKNRVTRSRSPTQVVKIKRFRRMKANDRERNRMHNLNDALEKLRVTLP 182
            :..||.|. .|:|: .:.|.:.|:.|    :.::| |||.:||.|||||||.|||||:.||..:|
  Rat    65 REEEDENG-LPRRR-GLRKKKTTKLR----LERVK-FRRQEANARERNRMHGLNDALDNLRKVVP 122

  Fly   183 SLPEETKLTKIEILRFAHNYIFALEQVLESGGSINLDLEKLQNFTLSGERITKELFDALFVNPQP 247
            ...:..||:|||.||.|.|||:||.::|..|...:| |..:||......:.|..|.....     
  Rat   123 CYSKTQKLSKIETLRLAKNYIWALSEILRIGKRPDL-LTFVQNLCKGLSQPTTNLVAGCL----- 181

  Fly   248 YPLFGRMFPYGQGMAPLAQHQTAPAS------HAEQ---PPAMGGFQHG-MDYPQQPPGFDFTGS 302
             .|..|.|..||| ...|.|..:|.|      |:.:   ||.     || :|..:....:::..:
  Rat   182 -QLNARSFLMGQG-GEAAHHTRSPYSTFYPPYHSPELATPPG-----HGTLDNSKSMKPYNYCSA 239

  Fly   303 MR-FYHQQQQQPHQPHH---LQPNPQQESSPQQFSQEKYDLFRGSFDAAANLHSTNLDSGIHQQS 363
            .. ||.....:...|..   |.|.|...:......||:      :.|     :..|.:.|:|   
  Rat   240 YESFYESTSPECASPQFEGPLSPPPINYNGIFSLKQEE------TLD-----YGKNYNYGMH--- 290

  Fly   364 SFYSQTPP 371
              |...||
  Rat   291 --YCAVPP 296

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tapNP_524124.1 HLH 155..207 CDD:278439 32/52 (62%)
Neurod6NP_001102707.1 HLH 100..151 CDD:197674 30/51 (59%)
Neuro_bHLH 153..272 CDD:315246 29/132 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C120209840
eggNOG 1 0.900 E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.