DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tap and NEUROD1

Sequence 1:NP_524124.1 Gene:tap FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_002491.2 Gene:NEUROD1 HGNCID:7762 Length:356 Species:Homo sapiens

Alignment Length:305 Identity:93/306 (30%)
Similarity:125/306 (41%) Gaps:64/306 (21%)


  Fly    57 PQPYSGGTWDAVPLSSPPAGFVGLLDTSSNHSTRSGRTLVEHLNSR---ATNG----VFDPPLTS 114
            |||....:|....|||          ....|........:|.:|:.   ..||    ..|..|..
Human    14 PQPQGPPSWTDECLSS----------QDEEHEADKKEDDLEAMNAEEDSLRNGGEEEDEDEDLEE 68

  Fly   115 TPVKSPEDPNAPRPKRKYAVGKNRVTRSRSPTQVVKIKRF--RRMKANDRERNRMHNLNDALEKL 177
            ...:..||.: .:|||: ...|.::|::|       ::||  ||||||.|||||||.||.||:.|
Human    69 EEEEEEEDDD-QKPKRR-GPKKKKMTKAR-------LERFKLRRMKANARERNRMHGLNAALDNL 124

  Fly   178 RVTLPSLPEETKLTKIEILRFAHNYIFALEQVLESGGSINLDLEKLQNFTLSG--ERITKELFDA 240
            |..:|...:..||:|||.||.|.|||:||.::|.||.|  .||.........|  :..|..:...
Human   125 RKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRSGKS--PDLVSFVQTLCKGLSQPTTNLVAGC 187

  Fly   241 LFVNPQPYPLFGRMFPYGQGMAPLAQH-QTAPASHAEQPPAMGGFQHGMDYPQQPPGFDFT--GS 302
            |.:||:.:     :....|.|.|   | .||.||....|           |..|.||....  |:
Human   188 LQLNPRTF-----LPEQNQDMPP---HLPTASASFPVHP-----------YSYQSPGLPSPPYGT 233

  Fly   303 MRFYHQQQQQPHQPHHLQPNPQQESSPQQ--FSQEKYDLFRGSFD 345
            |...|        ..|::|.|...|:..:  |.....|....|||
Human   234 MDSSH--------VFHVKPPPHAYSAALEPFFESPLTDCTSPSFD 270

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tapNP_524124.1 HLH 155..207 CDD:278439 33/52 (63%)
NEUROD1NP_002491.2 Nuclear localization signal. {ECO:0000255} 87..93 2/6 (33%)
HLH 100..158 CDD:238036 34/58 (59%)
Neuro_bHLH 160..284 CDD:315246 34/141 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C120185667
eggNOG 1 0.900 E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.