DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tap and Neurog2

Sequence 1:NP_524124.1 Gene:tap FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster
Sequence 2:XP_008759703.1 Gene:Neurog2 RGDID:1309061 Length:263 Species:Rattus norvegicus

Alignment Length:258 Identity:78/259 (30%)
Similarity:110/259 (42%) Gaps:83/259 (32%)


  Fly   113 TSTPVKSPED---------PNAPRPKRKYAVG--------------------------KNRVTRS 142
            |.||:.|..|         |.|.|.:|....|                          |.|.:|:
  Rat    29 TLTPMSSSADEEEDEELRRPGAARGQRGAEAGQGVQGSSASGAGGCRPGRLLGLVHECKRRPSRA 93

  Fly   143 RSPTQ-------VVKIKRFRRMKANDRERNRMHNLNDALEKLRVTLPSLPEETKLTKIEILRFAH 200
            |:.::       |.:||:.||:|||:||||||||||.||:.||..||:.||:.||||||.|||||
  Rat    94 RAVSRGAKTAETVQRIKKTRRLKANNRERNRMHNLNAALDALREVLPTFPEDAKLTKIETLRFAH 158

  Fly   201 NYIFALEQVLESGGSINLDLEKLQNFTLSGERITKELF-DALFVNPQPYPLFGRMFPYGQGMAP- 263
            |||:||.:.|           :|.:....|..:...|| :|:.::|.     ..:...|...:| 
  Rat   159 NYIWALTETL-----------RLADHCAGGGSLQGALFSEAVLLSPG-----AALGASGDSPSPS 207

  Fly   264 ----------LAQHQTAPASHAEQPPAMGGFQHGMDYPQQPPGFDFTGSMRFYHQQQQQPHQP 316
                      .:.:.|:|.|....|.:.|.   .:||.|.||.          .:.:..||.|
  Rat   208 SSWSCTNSPASSSNSTSPYSCTLSPASPGS---DVDYWQPPPP----------EKHRYAPHLP 257

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tapNP_524124.1 HLH 155..207 CDD:278439 39/52 (75%)
Neurog2XP_008759703.1 HLH 110..169 CDD:238036 41/70 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C120363427
eggNOG 1 0.900 E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001315
OrthoInspector 1 1.000 T617605
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR19290
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
65.890

Return to query results.
Submit another query.