DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tap and id2a

Sequence 1:NP_524124.1 Gene:tap FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_958448.1 Gene:id2a ZFINID:ZDB-GENE-020910-1 Length:137 Species:Danio rerio

Alignment Length:102 Identity:27/103 (26%)
Similarity:54/103 (52%) Gaps:17/103 (17%)


  Fly   115 TPVKSPEDPNAPRPKRKYAVGKNRVTRSRSPTQVVKIKRFRRMKANDRERNRMHNLNDALEKLRV 179
            :||:|....:|.....::::|   ::||::|.              |...:.::|:||...||:.
Zfish     5 SPVRSFRKSSASVTTTEHSLG---ISRSKTPV--------------DDPLSLLYNMNDCYSKLKE 52

  Fly   180 TLPSLPEETKLTKIEILRFAHNYIFALEQVLESGGSI 216
            .:||:|:...::|:|||:...:||..|:..|:|..:|
Zfish    53 LVPSIPQNKNVSKMEILQHVIDYILDLQIALDSNSAI 89

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tapNP_524124.1 HLH 155..207 CDD:278439 16/52 (31%)
id2aNP_958448.1 HLH <42..83 CDD:238036 15/41 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.