Protein Alignment tap and Id1

DIOPT Version :9

• Sequence 1: NP_524124.1
• Gene: tap / 39935
• FlyBaseID: FBgn0015550
• Length: 398
• Species: Drosophila melanogaster
• Sequence 2: NP_001355947.1
• Gene: Id1 / 15901
• MGIID: 96396
• Length: 168
• Species: Mus musculus
• Alignment Length: 50
• Identity: 15/50 - (30%)
• Similarity: 31/50 - (62%)
• Gaps: 0/50 - (0%)

  Fly   167 MHNLNDALEKLRVTLPSLPEETKLTKIEILRFAHNYIFALEQVLESGGSI 216
            ::::|....:|:..:|:||:..|::|:|||:...:||..|:..|.|...:
Mouse    59 LYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEV 108

Known Domains

Gene	Sequence	Domain	Region	External ID	Identity
tap	NP_524124.1	HLH	155..207	CDD:278439	12/39 (31%)
Id1	NP_001355947.1	Interaction with IFI204. /evidence=ECO:0000250	53..106		15/46 (33%)
		HLH	<61..102	CDD:238036	13/40 (33%)
		Nuclear export signal	91..104		4/12 (33%)

Information from Original Tools

Tool	Simple Score	Weighted Score	Original Tool Information
			BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910