DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tap and BHLHE23

Sequence 1:NP_524124.1 Gene:tap FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_542173.2 Gene:BHLHE23 HGNCID:16093 Length:241 Species:Homo sapiens

Alignment Length:246 Identity:64/247 (26%)
Similarity:89/247 (36%) Gaps:66/247 (27%)


  Fly    32 KSFETEAQL-------SSRRRLDFGTPPTPAIPQPYS----GGTWDAVPLSSPPAGFVGLLDTSS 85
            ||...:|.|       ::...|.:|....|...:.|.    ||...|.|....||      ..:.
Human    21 KSLSGDAYLALSHGYAAAAAGLAYGAAREPEAARGYGTPGPGGDLPAAPAPRAPA------QAAE 79

  Fly    86 NHSTRSGRTLVEHLNSRATNGVFDPPLTSTPVKSPEDPNAPRPKRKYAVGKNRVTRSRSPTQVVK 150
            :...:||                           .||....:.:|:...|.....|.|...|   
Human    80 SSGEQSG---------------------------DEDDAFEQRRRRRGPGSAADGRRRPREQ--- 114

  Fly   151 IKRFRRMKANDRERNRMHNLNDALEKLRVTLP--SLPEETKLTKIEILRFAHNYIFALEQVLESG 213
              |..|:..|.|||.|||:|||||:.||..:|  ..|...||:||..|..|.|||....|.|:  
Human   115 --RSLRLSINARERRRMHDLNDALDGLRAVIPYAHSPSVRKLSKIATLLLAKNYILMQAQALD-- 175

  Fly   214 GSINLDLEKLQNFTLSGERITKELFDALFVNPQPYPLFGR--MFPYGQGMA 262
                 ::.:|..|...|:.:      |..||..|...||:  :.|:..|.|
Human   176 -----EMRRLVAFLNQGQGL------AAPVNAAPLTPFGQATVCPFSAGAA 215

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tapNP_524124.1 HLH 155..207 CDD:278439 26/54 (48%)
BHLHE23NP_542173.2 HLH 122..176 CDD:197674 27/61 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C120317082
eggNOG 1 0.900 E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.