DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: tap and neurod1

Sequence 1:NP_524124.1 Gene:tap FlyBaseID:FBgn0015550 Length:398 Species:Drosophila melanogaster
Sequence 2:NP_001090868.1 Gene:neurod1 XenbaseID:XB-GENE-963757 Length:361 Species:Xenopus tropicalis

Alignment Length:308 Identity:85/309 (28%)
Similarity:120/309 (39%) Gaps:87/309 (28%)


  Fly   121 EDPNAPRPKRKYAVGKNRVTRSRSPTQVVKIKRF--RRMKANDRERNRMHNLNDALEKLRVTLPS 183
            ||.:..:|||: ...|.::|::|       ::||  ||||||.|||||||.||.||:.||..:|.
 Frog    81 EDDDDQKPKRR-GPKKKKMTKAR-------VERFKVRRMKANARERNRMHGLNAALDNLRKVVPC 137

  Fly   184 LPEETKLTKIEILRFAHNYIFALEQVLESGGSINLDLEKLQNFTLSG--ERITKELFDALFVNPQ 246
            ..:..||:|||.||.|.|||:||.::|.||.|  .||.........|  :..|..:...|.:||:
 Frog   138 YSKTQKLSKIETLRLAKNYIWALSEILRSGKS--PDLVSFVQTLCKGLSQPTTNLVAGCLQLNPR 200

  Fly   247 -------------------PYPLFGRMFPYGQGMAPLAQHQTAPASHA--EQPPAMGG------- 283
                               .:||  ..|||.....|...:.|..:||.  .:|.:.|.       
 Frog   201 TFLPEQSQDIPSHMQASSASFPL--HPFPYQSPGLPSPPYGTMDSSHVFHVKPHSYGSALEPFFD 263

  Fly   284 ------FQHGMDYPQQPPGFDFTGSMRFYHQQQQQPHQPHHLQPNPQQESSPQQFSQEKYDLFRG 342
                  .....|.|..|| ....|:..|.|:              |..|          ||.   
 Frog   264 STVTDCTSPSFDGPLSPP-LSVNGNFTFKHE--------------PSAE----------YDK--- 300

  Fly   343 SFDAAANLH--STNLDSGIHQQSSFYSQTPPWKDYPED-----QAHVH 383
              :.|..:|  :..:.:......|.:|...|..:.|.|     :.|.|
 Frog   301 --NYAFTMHYPAATMAAAAQGHGSLFSTGAPRCEIPIDSMMSYEGHSH 346

Known Domains:


GeneSequenceDomainRegion External IDIdentity
tapNP_524124.1 HLH 155..207 CDD:278439 33/52 (63%)
neurod1NP_001090868.1 HLH 107..165 CDD:238036 34/58 (59%)
Neuro_bHLH 167..288 CDD:315246 25/126 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C120185311
eggNOG 1 0.900 E1_KOG3898
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.