DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6497 and CG13725

Sequence 1:NP_001261980.1 Gene:CG6497 FlyBaseID:FBgn0036704 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_648967.1 Gene:CG13725 FlyBaseID:FBgn0036708 Length:199 Species:Drosophila melanogaster

Alignment Length:169 Identity:43/170 (25%)
Similarity:77/170 (45%) Gaps:34/170 (20%)


  Fly    46 DLMYWKRLAEVFSQDIDCIQLAILLLIFAIN-AIFVFIILSVYLRPALDNGSE----MSLLEIKD 105
            ||..|....|.     :.|.|.:|:.|..:. ||.:|:.|..:.|...:...|    |.:..::.
  Fly    42 DLFCWFETVEE-----ENIPLTVLMYIGGLKVAIILFLALWCWTREEAEKNQEGNMDMPISYVRK 101

  Fly   106 RYARFILLRLIARLDRI---QSKISAKRKSLTFQHYVRAHTNMVKAVAVFRKDARKLILPNESEI 167
            ||.||:::.|:|.:||:   .|.|         ..::::..:..:||..||..||:|....:.::
  Fly   102 RYCRFLVMNLLASVDRLIHHHSHI---------DDFLQSRKDCGEAVEQFRWRARRLFERTDLQL 157

  Fly   168 LMPIEDIYGVADDEERLLRRSGY------------YKLI 194
            .:|:.::..|.|.:|:.|.|.||            ||:|
  Fly   158 CVPLHEVLSVDDPQEKELLRLGYGDKLAQLRELDVYKMI 196

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6497NP_001261980.1 DUF4736 32..207 CDD:292508 43/170 (25%)
CG13725NP_648967.1 DUF4736 35..199 CDD:292508 43/170 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134651467
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.