DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6497 and CG32161

Sequence 1:NP_001261980.1 Gene:CG6497 FlyBaseID:FBgn0036704 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_730205.1 Gene:CG32161 FlyBaseID:FBgn0052161 Length:228 Species:Drosophila melanogaster

Alignment Length:218 Identity:53/219 (24%)
Similarity:99/219 (45%) Gaps:35/219 (16%)


  Fly    16 HANYPYIALYSGLGVAVTAYLHYQWSVHHYDLMYWKRLAEVFSQDIDCIQLAILLLIFAINAIFV 80
            |.|:..:||.:...|.:...||||.:.|..||.:|            |.:|...|:.:.::|:.:
  Fly    26 HFNHCTLALATLDLVCIVCLLHYQLARHGRDLFFW------------CEELDQRLVEYMLSAVVL 78

  Fly    81 FIILSVYLRPALDNGSEMSLLEIK------------DRYARFILLRLIARLD---RIQSKIS--A 128
            ...:|| |...:|.....:|::.|            |||.||:.:||:.:|:   ::|:|.|  .
  Fly    79 MASVSV-LGSCVDGFIFSALVQRKMSRFDMPRQYFEDRYRRFVFMRLVRQLEQALKVQAKQSELG 142

  Fly   129 KRKSLTFQHYVRAHTNMVKAVAVFRKDARKLILPNESEILMPIEDIYGVADDEERLLRRSGYYKL 193
            :|......:...|...:.:|:..||...|.|:.||.|::|.....::.:::.:...|...||   
  Fly   143 ERMMTPLANLFEAQQLIKEAIDEFRTAVRVLLWPNRSDVLAEAFVLFHISESQLSDLTLQGY--- 204

  Fly   194 IIDTTDETVKSLFNAKLEEILFP 216
              ...|...:.:.|::|.::|.|
  Fly   205 --RLNDVEGEDMSNSRLSQMLNP 225

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6497NP_001261980.1 DUF4736 32..207 CDD:292508 44/192 (23%)
CG32161NP_730205.1 DUF4736 42..224 CDD:292508 47/200 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134651501
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.