DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7730 and pst

Sequence 1:NP_788521.2 Gene:CG7730 FlyBaseID:FBgn0036689 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_729246.2 Gene:pst FlyBaseID:FBgn0035770 Length:707 Species:Drosophila melanogaster

Alignment Length:703 Identity:236/704 (34%)
Similarity:347/704 (49%) Gaps:135/704 (19%)


  Fly     6 NTKNSRTTYEVQRDFGFSSGLRSEIIWDSLAPDQGDVLKQKIENLIRDD-------DARNGKAI- 62
            |.:.:||..|||::|..|.|...|||||.|:.:|.|||:.|:..||||.       :....:.| 
  Fly     7 NHEVTRTAREVQQNFAESLGYAEEIIWDLLSHEQHDVLRGKLCQLIRDSPEPKTATETEKDRKIR 71

  Fly    63 -------QRKREQLFRNIWQQR---------------------C----YTNGTLLSAIIYVL-VT 94
                   :|.|:.:|.::||||                     |    |||...|:|||||: ||
  Fly    72 LKVNADNERARQIIFDSVWQQRELDLQIVYSIVHFFAALTAYNCFPGKYTNRQSLTAIIYVMVVT 136

  Fly    95 PDTDPESALQSTNYSCHPVFRTRRCLKGEN-----SAACCMIFVDENARVYANWEQFVFRNTLPK 154
            .:||...|..:..:|.|||||.|||:.|.:     |:.||.:|:||..|||.|||.:|..|.||.
  Fly   137 DETDVNRAEDARVFSVHPVFRARRCVVGSSGTSSVSSNCCNLFIDELGRVYQNWEMYVTTNELPA 201

  Fly   155 GLMIAPSQGIYTFTGDEEPGVQLMVHPTPAARARYKILNAGDKVATVGSLVAS-VPAAAALAVPL 218
            |:|:||.:|||....|:   |:|..:.|||.....|:|...|..:.||...|: ||.||.|.:|:
  Fly   202 GVMVAPEKGIYRLVRDQ---VRLDKYTTPAGTTNRKVLGYLDTGSAVGGFFAACVPIAALLTLPV 263

  Fly   219 GAPLAIAATAVGVATGVYSTLRSASHLIDRRRHGQSTCITDTEARSSWLGVAGGVVGLGASGATK 283
            .|||..||..||:|:..|:..||.|.|.||.:|.||..:||.|||..|||||||.|||.|:|||.
  Fly   264 SAPLMGAAGVVGLASAGYAASRSGSKLFDRSQHEQSINVTDREARGHWLGVAGGTVGLAAAGATT 328

  Fly   284 ALSTAAGAGYKVNPAAQLAVRGINGASMVIAGTGVANGVYDLYSKHGDDQAINSLDMLKMASHLV 348
            .|:||..||.:|....||.|..:|.:|:|::||||||||.||..|..|...|.::|:|::::.||
  Fly   329 VLTTATNAGREVGAITQLTVNSMNISSIVVSGTGVANGVLDLILKAKDGDEIVAMDVLQLSASLV 393

  Fly   349 IFTHSINNMRIASKATNGSS------LRRALRNQSRKIFDRISQETVKLH-NESGQFDIVRTLNE 406
            :.|||:.|.::||...|.:|      .|:.|.|:.|:.||:.::|||::. |..|:.||:|.:||
  Fly   394 LLTHSVYNFKLASTIINETSNANIADYRKNLSNRQRRTFDKAAKETVRMQGNTRGKLDIIRNVNE 458

  Fly   407 IPFKEVLLSLHNMNSHLSQ---------------------------------------------- 425
            |..:| ...|..:|.:|:|                                              
  Fly   459 ISPQE-FNDLFKINKNLNQEGVRYSFAPDGKGFLLNGDVQTTGAELRASVQHNQGGNVLGKVSQP 522

  Fly   426 --------------GLTVATTLL-----------PQILSYGI-----GGQMVINMDMLAQKFGGK 460
                          |:...:.|:           |...:.|:     ...:|..:..:.:|:|..
  Fly   523 IPGSHAGSGRLQLGGVNQVSRLIGPLPTSHPRQEPSTYAAGVFALELSSVLVGGVVFVLEKYGKI 587

  Fly   461 FVEHIGNLASFTDVLEAMARYFSDQAVQLLMQMTRTFVEENVDYIDRSLNTFVSTEAVLYRILMH 525
            ..||:.|..||..::..||.....:....:|.:||.|::..::.:...|..|:|||:||||||::
  Fly   588 IFEHVINAESFESLINIMANKLDPKVFDHIMLLTRAFMDTMLEDLTSVLKFFISTESVLYRILLY 652

  Fly   526 CVKTFDDFGEDFLQRQREDILMVVSKYFRSLEPVGEQNCRKYKCNVCKGAYYI 578
            .::.|:|.....:.....:|:..|..||.||.|.......: ||..|.|.:.:
  Fly   653 ILRNFEDVQLSVIADHTCEIVEAVRVYFMSLNPNAFPGLLQ-KCPKCIGHFSV 704

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7730NP_788521.2 DUF4781 111..403 CDD:292632 138/305 (45%)
pstNP_729246.2 DUF4781 153..455 CDD:292632 138/305 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134581892
eggNOG 1 0.900 E1_2BVI7
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0012261
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21115
RoundUp 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.