DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7730 and CG32243

Sequence 1:NP_788521.2 Gene:CG7730 FlyBaseID:FBgn0036689 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_729014.1 Gene:CG32243 FlyBaseID:FBgn0052243 Length:485 Species:Drosophila melanogaster

Alignment Length:590 Identity:144/591 (24%)
Similarity:246/591 (42%) Gaps:144/591 (24%)


  Fly    12 TTYEVQRDFGFSSGLRSEIIWDSLAPDQGDVLKQKIENLIRDDDARNGKAIQRKREQLFRNIWQQ 76
            |..|||:.|....|..::|.||.::..|.::||.|:..|..|.:             :|..||..
  Fly    13 TVREVQQKFADILGHGNDITWDLISSGQENILKAKLSLLNFDSN-------------MFHAIWSY 64

  Fly    77 RCYTNGTLLSAIIYVLVTPDT-DPESALQSTNYSCHPVFRTRRCL--KGENS-AACCMIFVDENA 137
            |.|:.|..|:::.:|:|..:. ||:.|.:|.::..:||||.|||:  .|.:| ..|||.:|.:.:
  Fly    65 RKYSKGQSLTSLFFVMVVNNVYDPKLAEESRSWRLYPVFRCRRCVDETGHSSNIDCCMSYVSQYS 129

  Fly   138 RVYANWEQFVFRNTLPKGLMIAPSQGIYTFTGDEEPGVQLMVHPTPAARARYKILNAGDKVATVG 202
             :..:|.:||.......|||:.|..|:|..|   :..|:|..:.|.      :|.:...|     
  Fly   130 -MSDSWNRFVTHTGFAAGLMVTPYLGVYKQT---DGRVELKTYTTT------QIWHPNKK----- 179

  Fly   203 SLVASVPAAAALAVPLGAPLAIAATAVGVATGVYSTLRSASHLIDRRR----HGQSTCITDTEAR 263
                .:|...                        .:|:.||.:.::.|    |.....:...|  
  Fly   180 ----DIPITP------------------------ESLKKASSVTNKLRKIIIHSVPFLVYPEE-- 214

  Fly   264 SSWLGVAGGVVGLGASGATKALSTAAGAGYKVNPAAQLAVRGINGASMVIAGTGVANGVYDLYSK 328
                     |....||  .|.||:.      :||                               
  Fly   215 ---------VFDFCAS--EKMLSSI------LNP------------------------------- 231

  Fly   329 HGDDQAINSLDMLKMASHLVIFTHSINNMRIASKATNGSSLRRALRNQSRKIFDRISQETVKLHN 393
            |...|   |.|:..::..||:||:::.|.|:.|...|.::......||.|..:|:|::|:.|:  
  Fly   232 HSSTQ---SGDVAGLSDSLVLFTNNLYNSRLESLMNNNNNDPSIFVNQQRSAWDKIARESFKI-- 291

  Fly   394 ESGQFDIVRTLNEIPFKEVLLSLHN-MNSHLSQGLTV--------ATTLLPQI---LSYGIGGQM 446
             .|..:::|..|.:|....|..:.. ::|.:.:...|        ..:.||:|   ||..:.|| 
  Fly   292 -EGNVNLIRCCNGVPSIPKLDKIFQPIDSKIKKSKKVVEAEKPENTPSDLPEIEIDLSIKVKGQ- 354

  Fly   447 VINMDMLAQKFGGKFVEHIGNLASFTDVLEAMARYFSDQAVQLLMQMTRTFVEENVDYIDRSLNT 511
            .||:    :::|.:..:||.:..||..::..|:.:......:|:|.:|:||||...:.:.:.|..
  Fly   355 EINL----REYGTQLKKHIASSESFDILISRMSEHLEVDTFKLIMALTQTFVETVREEMCQMLKY 415

  Fly   512 FVSTEAVLYRILMHCVKTFD---DFGEDFLQRQREDILMVVSKYFRSLEPVGEQNCRKYKCNVCK 573
            :..||::||:|:: |:....   ||.|  ::....|||..|..:|.|..|.......| ||.||.
  Fly   416 YFPTESILYQIIL-CISKHHPKWDFNE--IEEHSSDILRRVRMFFVSTGPNPYAEFLK-KCEVCP 476

  Fly   574 GAYYI 578
            |.|.|
  Fly   477 GYYDI 481

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7730NP_788521.2 DUF4781 111..403 CDD:292632 64/299 (21%)
CG32243NP_729014.1 DUF4781 101..>170 CDD:292632 25/73 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134581914
eggNOG 1 0.900 E1_2BVI7
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR21115
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.