DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7730 and F02C12.1

Sequence 1:NP_788521.2 Gene:CG7730 FlyBaseID:FBgn0036689 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_510230.4 Gene:F02C12.1 WormBaseID:WBGene00008515 Length:817 Species:Caenorhabditis elegans

Alignment Length:549 Identity:122/550 (22%)
Similarity:220/550 (40%) Gaps:142/550 (26%)


  Fly    33 DSLAPDQGDVLKQKIENLIRDDDARNGKAIQRK----------------------REQLF---RN 72
            :||.|||...|.:.:|  :...:|.|....::|                      |::||   |.
 Worm   209 NSLMPDQLQELMKTME--LEAKEANNNSKSKKKIDLKFVPEFGYTEEQEDHIIKLRDELFDINRR 271

  Fly    73 IWQQRCYTNGTLLSAIIYVLVTPDTDPESALQSTNYSCHPVFRTRRCLKGENSAACCMIFVDENA 137
            ..:|:...:..:.:..::|....|....:.|        |:.    ||:..::.   :::|:...
 Worm   272 QKKQKEGESNIVETKFVFVSFFADGSHSNIL--------PLI----CLRISDTK---IMYVESTG 321

  Fly   138 RVYANWEQFVFRNTLPKGLMIAPSQGIYTFTGDEEPGVQLMVHPTPAARARY--KILNAGDKVAT 200
            |.|.:||.|:.:|.||:..::.|..|:|    :.|||..|.:....:.|::.  ||....|:.|.
 Worm   322 RAYDDWEDFLNKNKLPECNILYPDGGLY----ELEPGGILNLRYDISRRSKLPSKIAKISDRSAM 382

  Fly   201 VGSLVASVPAAAALAVPLGAPLA---IAATAVGVATGVYSTLRSASHLIDRRRHGQSTCITDTEA 262
            ...:.|::.:...|..|| ||:|   :..||:|  |||||..||..|::||..|.::  :....:
 Worm   383 GIGVAATIGSVIGLFTPL-APVAATTLLYTAIG--TGVYSMARSGYHIVDRVIHNEN--VNPLRS 442

  Fly   263 RSS---WLGVAGGVVGLGASGATKALSTAAGAGYKVNPAAQLAVRGINGASMVIAGTGVANGVYD 324
            |.:   ||.||..:...||.|.:..|:.....|.:|:.|.:..|.....|:..::|..:....|:
 Worm   443 RENFVDWLAVAASLASFGAIGGSAYLTVMTTQGLEVSQAIEYTVNAAIFANFAVSGIALTASGYN 507

  Fly   325 LYSKHGDDQAINSLDMLKMASHLVIFTHSINNMRIASKATNGSS------LRRALRN-QSRKIFD 382
            ::.|..:.:....|::.:.::.|:.||::..|::.|.|....::      .|..|:. :.::.||
 Worm   508 IFEKVANGERPTPLELFQFSTSLLFFTNAAVNLQTAEKLIQQTTQEKINDYRDTLKTAEDKQQFD 572

  Fly   383 RISQETVKLHNESGQ-------------FDIVRTL------------NEIPFKEVLLSLHNMNSH 422
            :...|.:|  |..||             .||.:.:            :::|.|...:...::...
 Worm   573 QKINENMK--NTEGQQGNSKMKANLETIKDIHKAMLADKHVEAHIHEHDVPKKSKPMPSSSVPKM 635

  Fly   423 LSQGLTVA---------------------------TTLL-----------PQILSYGIGGQM--- 446
            .::.|||:                           ||.|           ..|||.|.||.:   
 Worm   636 QAKQLTVSDKKIVEEHLQALDARGQSKLPASKQKITTYLNVGWDDIAAKVKAILSGGAGGALTER 700

  Fly   447 --------VINMDMLAQKFGGKFVEHIGN 467
                    ||.||...:.|.|..||.|.|
 Worm   701 LIDGKTKKVITMDNGDEGFMGAKVESIPN 729

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7730NP_788521.2 DUF4781 111..403 CDD:292632 80/320 (25%)
F02C12.1NP_510230.4 ZnF_ZZ 19..63 CDD:197633
ZnF_ZZ 93..132 CDD:197633
DUF4781 303..600 CDD:292632 78/315 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134582009
eggNOG 1 0.900 E1_2BVI7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0012261
OrthoInspector 1 1.000 T375186
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR21115
Phylome 1 0.910 0.833 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.800

Return to query results.
Submit another query.