DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment a10 and EbpIII

DIOPT Version :8

Sequence 1:NP_524121.2 Gene:a10 / 39906 FlyBaseID:FBgn0011293 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_001286808.1 Gene:EbpIII / 49821 FlyBaseID:FBgn0011695 Length:126 Species:Drosophila melanogaster

Alignment Length:99 Identity:48/100 (48%)
Similarity:72/100 (72%) Gaps:0/100 (0%)


  Fly    47 EQAYDDKFDNVDLDEILNQERLLINYIKCLEGTGPCTPDAKMLKEILPDAIQTDCTKCTEKQRYG 111
            |..|..|:||:|:||||..:||..||.|||...|.|||:.:.||:.||||::|:|:||:||||..
  Fly    18 EDKYTTKYDNIDVDEILKSDRLFGNYFKCLVDNGKCTPEGRELKKSLPDALKTECSKCSEKQRQN 82

  Fly   112 AEKVTRHLIDNRPTDWERLEKIYDPEGTYRIKYQ 145
            .:||.|::|:|:|.:|::|:..|||:..|..:|:
  Fly    83 TDKVIRYIIENKPEEWKQLQAKYDPDEIYIKRYR 116

Known Domains:


GeneSequenceDomainRegion External IDIdentity
a10NP_524121.2 OS-D 50..141 CDD:281395 46/91 (51%)
EbpIIINP_001286808.1 OS-D 21..113 CDD:281395 46/92 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131091745
eggNOG 1 0.900 E1_2CRZI
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11257
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.