DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment a10 and Phk-3

DIOPT Version :8

Sequence 1:NP_524121.2 Gene:a10 / 39906 FlyBaseID:FBgn0011293 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_001286870.1 Gene:Phk-3 / 37997 FlyBaseID:FBgn0035089 Length:121 Species:Drosophila melanogaster

Alignment Length:129 Identity:53/130 (41%)
Similarity:80/130 (62%) Gaps:14/130 (11%)


  Fly    17 VALMCTTCFQVEGLPHPPATSPSPMMERMVEQAYDDKFDNVDLDEILNQERLLINYIKCLEGTGP 81
            :||:...|.   ||   .|.:|        |:.|.:|:|:|::||:|...|:|.||:|||...||
  Fly     5 LALVFCVCV---GL---AAAAP--------EKTYTNKYDSVNVDEVLGNNRVLGNYLKCLMDKGP 55

  Fly    82 CTPDAKMLKEILPDAIQTDCTKCTEKQRYGAEKVTRHLIDNRPTDWERLEKIYDPEGTYRIKYQ 145
            ||.:.:.||.:||||:.:||:||||.||..::||..:|..|:..:|:.|...|||:|.||.|::
  Fly    56 CTAEGRELKRLLPDALHSDCSKCTEVQRKNSQKVINYLRANKAGEWKLLLNKYDPQGIYRAKHE 119

Known Domains:


GeneSequenceDomainRegion External IDIdentity
a10NP_524121.2 OS-D 50..141 CDD:281395 43/91 (47%)
Phk-3NP_001286870.1 OS-D 24..115 CDD:281395 43/91 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131091784
eggNOG 1 0.900 E1_2CRZI
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11257
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.