DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6652 and Lca5

Sequence 1:NP_648946.3 Gene:CG6652 FlyBaseID:FBgn0036687 Length:604 Species:Drosophila melanogaster
Sequence 2:NP_081724.1 Gene:Lca5 MGIID:1923032 Length:704 Species:Mus musculus

Alignment Length:681 Identity:140/682 (21%)
Similarity:266/682 (39%) Gaps:152/682 (22%)


  Fly     8 ASSYGPRVSQSEPNNLMAASAKSCESLFSASSRE-------SASLIY----QRSKPPPPQQRGGV 61
            :|.:|.....|.|::  ..:...|     ||:||       |.:.::    ::..|.....:.|:
Mouse    25 SSDFGSSPQSSGPSS--PVNTTPC-----ASTREKNPKRHLSDNQVHHPTVRKVSPKAVPSKKGI 82

  Fly    62 KGSGSMSSQNHSEIH-------QRVMSARNLRAKTFQNQLADAQAEIANLAHENRMLRTLHNRQS 119
            :......|.|...:.       :||:|||.|:....||::::.|.::|.|..||:.|::|..||.
Mouse    83 RVGFRSQSLNREPLRKDPDIVTKRVLSARLLKINELQNEVSELQVKLAQLLKENKALKSLQYRQE 147

  Fly   120 SALNKYEAHNAELPKLLSSHAEELRMWQTKYRKLQAANKALELKLKQKEEIILTLSDQNKHYSQL 184
            .||||:|....|:.:|:..|..|:...:.:.||.|...:|.|.::|:.|..:.......:...::
Mouse   148 KALNKFEDAENEISQLIHRHNNEITALKERLRKSQEKERATEKRVKETEGELFRTKFSLQKLKKI 212

  Fly   185 NKDKNLDERQKLQEKLKSLEQRLEEKDNDMKLMARKVQLESKNIRQQLLNEQRKGKEV-----ML 244
            ::.::|.||..|.:||.|.|.:|::.:..:|.:::.::|.:.:.::|||.|:::..|.     :|
Mouse   213 SEARHLPERDDLAKKLVSAELKLDDTERKIKELSKNLELSTNSFQRQLLAERKRAFEAYDENKVL 277

  Fly   245 KLEKAKLEISGYRKLEEYTLGTDKVN------PLSSGRRTK---LSGVTDEPDKIDKLEKSM--- 297
            :.|..:|    :.||:|.....|..|      |.||.::.|   ...|:.:.|..|:..|.:   
Mouse   278 QKELQRL----HHKLKEKEKELDIKNIYANRLPKSSPKKEKEIERKHVSCQSDFTDQCTKGVQTA 338

  Fly   298 -------------------------EMLDKAIEKN--NQSEFTALTDVMESESFYDFEKDSAEDK 335
                                     |.|...:|..  |:.....|:.|:..|..||.::|....|
Mouse   339 EDFELEDFPFTAQTVLCYENRWDEPEYLSSYLEYQDLNKHGSEMLSSVLGQEGKYDEDEDPCSAK 403

  Fly   336 SGPNTPPSQIERQ----------VGGRGGKLILP----PATNHA-----KMGQKANRSTLSQVLS 381
            .....|.|:..|:          :.||..||.|.    |..|:.     |...:|.|.....:|:
Mouse   404 QEARKPESEWAREELDKVKGKSALLGRAEKLALEAGRFPTENYQAQSVDKFEDEAERLKTEMLLA 468

  Fly   382 AQGKISVSSGKSAKSRIAVAVPKMESVQVSKRREPETVSR-----LASAETK---PKQKPLEYEY 438
            ...:|:                       .:.::|:.:.|     |.:.|:|   |.:....|.:
Mouse   469 KLNEIN-----------------------KELQDPQNLGRAPLPLLPNFESKLHSPDRSTRPYSF 510

  Fly   439 EDDYEPA--GEDGDDDAYGMMSKMCEGEEP-------QDNSEENANESSLLKYSAYMDNKSSEGD 494
            .:..:.:  |:...|.::  ::...||..|       |..|....:|.|...|.........:.:
Mouse   511 PESLDRSFNGQHLQDLSF--LTPRGEGGSPGPIRSPGQIRSPAPLDEFSFGSYVPSFGKTLGKSN 573

  Fly   495 PLEESMEEYD-GTDGQQSQGSDDEDISVRAPRLKENMSSLRKQISNDFKERESFLKTFCRQASNS 558
            |..:.....| .::..:|...|..|:..|    ||..::|.:|:             |...|||:
Mouse   574 PPSQKSSLLDFQSNSSESPSKDSLDLMSR----KEKKATLMEQL-------------FGPSASNT 621

  Fly   559 NMRDDSASKKRNSIATGAAASSHMTGSRKNA 589
            ::...|......:.:.|.....|.....:|:
Mouse   622 SVSSKSTDPHFPAASRGDMDPLHFLSGDRNS 652

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6652NP_648946.3 Lebercilin 82..257 CDD:292252 49/180 (27%)
GBP_C <151..252 CDD:303769 26/106 (25%)
coiled coil 239..250 CDD:293879 3/16 (19%)
Lca5NP_081724.1 DUF342 <82..186 CDD:302792 31/104 (30%)
Lebercilin 110..289 CDD:292252 51/183 (28%)
GluZincin 152..>288 CDD:301352 33/140 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C217677660
eggNOG 1 0.900 E1_28I5W
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005917
OrthoInspector 1 1.000 T616927
orthoMCL 1 0.900 OOG5_137260
Panther 1 1.100 O PTHR16650
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5200
TreeFam 1 0.960
87.820

Return to query results.
Submit another query.