DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6652 and Lca5l

Sequence 1:NP_648946.3 Gene:CG6652 FlyBaseID:FBgn0036687 Length:604 Species:Drosophila melanogaster
Sequence 2:XP_006248240.1 Gene:Lca5l RGDID:1562512 Length:734 Species:Rattus norvegicus

Alignment Length:589 Identity:130/590 (22%)
Similarity:236/590 (40%) Gaps:94/590 (16%)


  Fly    15 VSQSEPNNLMAASAKSCESLFSASSRESASLIYQRSKPPPPQ-------QRGGVKGSGSMSSQ-- 70
            ||:.:|..|:              .:|.....|...|.|.|:       ::..:..:...|||  
  Rat    85 VSRHQPEQLL--------------GKEKEKRKYNTCKFPQPKGQKDIPAEKRHIWNASFFSSQIQ 135

  Fly    71 ----NHSEIHQRVMSARNLRAKTFQNQLADAQAEIANLAHENRMLRTLHNRQSSALNKYEAHNAE 131
                ....:..|::|||..:.|..:|:|||...::.....||:.|:.|..|...|:..|......
  Rat   136 TIAKRRDTMTHRILSARLHKIKELKNELADIHRKLEATILENQFLKQLQLRHLKAIGTYVNSQNN 200

  Fly   132 LPKLLSSHAEELRMWQTKYRKLQAANKALELKLKQKEEIILTLSDQNKHYSQLNKDKNLDERQKL 196
            ||::...|..|::..:...||.|...:|:..||::.:..:|...|..:...:|::||||.||::|
  Rat   201 LPQITVKHQNEVKNLRQLLRKSQEKERAVSRKLRETDSELLRTKDALQALQRLSEDKNLAEREEL 265

  Fly   197 QEKLKSLEQRLEEKDNDMKLMARKVQLESKNIRQQLLNEQRKGKEVMLKLEKAKLEISGY----- 256
            ..:|..|..::|..|..::.:.::::|.:::..:||..|.||........:..:.|:...     
  Rat   266 THRLTDLTAKMEANDKKIQNLEKQLRLNNRSFSRQLAKENRKTLAAQTATKALQAEVRQLQQKLK 330

  Fly   257 ---RKLEEYTLGTDKVNPLSSGRRTKLSGVTDEPD--KIDKLEKSMEMLDKAIE-KNNQSEFTAL 315
               |:||...:.|:::          |..:.|:.|  |:.. .||::...|::. .|.:.:.|..
  Rat   331 EKDRELEIKNIYTNRI----------LKNLHDKEDYPKVSS-TKSVQADRKSLPFVNVRHQETQK 384

  Fly   316 TDVMESESFYDFEKDSAEDKSGPNTPPSQIERQVGGRGGKLILPPATNHAKMGQKANRSTLSQVL 380
            :||    .|:..:...|:.........::|...:.....||   |....:|...:||.:.|..:.
  Rat   385 SDV----PFWITKDKKAKGNIVHKEKSTEINHDISYHVRKL---PRQEESKRKCEANLTVLKNMP 442

  Fly   381 SAQGKISVSSGKSAKSRIAVAVPKMES-VQVSKRREPETVSRLASAET--KPKQKPLEYE---YE 439
            |.:    ||..:.|..:|.....:..| .|....:|.|......|.||  :||::..:.|   ..
  Rat   443 SPR----VSWEQVATEQICAFHLECHSCTQTDLSKEVEHPKPQTSLETPRRPKERKEDQEKRAIP 503

  Fly   440 DDYEPAG------EDGDDDAYGMMSKMCEGEEPQDNSEENANESSLLKYSAYMDNKSSEG---DP 495
            ::.||..      ||.:|.|  :....|:..:..|..:  |.::         |:.|..|   |.
  Rat   504 EEAEPTAKGSEVPEDAEDKA--LARAACDVGDAGDAGD--AGDA---------DHASDAGDVRDV 555

  Fly   496 LEES----MEEYDGTD--GQQSQGSDDEDISVRAPRLKENMSSLRKQISNDFKERESFLKTFCRQ 554
            :|:|    ..|..|.:  |:....|:..|:.....|.|...|......:...:.....|.|.|||
  Rat   556 VEDSEVIGAHELPGANQAGEVHGASEAGDVEPGRGRRKTPRSRKHYSFTEATENLHHGLPTSCRQ 620

  Fly   555 ASNS 558
            ||.|
  Rat   621 ASGS 624

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6652NP_648946.3 Lebercilin 82..257 CDD:292252 45/183 (25%)
GBP_C <151..252 CDD:303769 26/101 (26%)
coiled coil 239..250 CDD:293879 0/11 (0%)
Lca5lXP_006248240.1 Lebercilin 151..330 CDD:292252 45/179 (25%)
SPEC 167..337 CDD:295325 40/170 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C217679097
eggNOG 1 0.900 E1_28I5W
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR16650
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
43.890

Return to query results.
Submit another query.