DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6652 and Lca5l

Sequence 1:NP_648946.3 Gene:CG6652 FlyBaseID:FBgn0036687 Length:604 Species:Drosophila melanogaster
Sequence 2:NP_001001492.2 Gene:Lca5l MGIID:3041157 Length:735 Species:Mus musculus

Alignment Length:681 Identity:148/682 (22%)
Similarity:248/682 (36%) Gaps:180/682 (26%)


  Fly    30 SCESL---------FSASSRESASLIYQRSKP-------------PPPQQRGGVK---------G 63
            ||.||         |.:...|:|....|..||             ..||.||...         .
Mouse    62 SCTSLTSHYDYSEDFLSDCSETAVRRLQSEKPLAKAKEKRKYNAGKLPQPRGQKDIPAEKKQFWN 126

  Fly    64 SGSMSSQ------NHSEIHQRVMSARNLRAKTFQNQLADAQAEIANLAHENRMLRTLHNRQSSAL 122
            :..:|||      ....:..|::|||..:.|..:|:|||...::...|.||:.|:.|..|...|:
Mouse   127 ASLISSQIQTIAKRRDTMTHRILSARLHKIKELKNELADVHRKLEASAIENQFLKQLQLRHLKAI 191

  Fly   123 NKYEAHNAELPKLLSSHAEELRMWQTKYRKLQAANKALELKLKQKEEIILTLSDQNKHYSQLNKD 187
            .||......||::.:.|..|::..:...||.|...:|:..||::.:..:|...|..:...:|::|
Mouse   192 GKYVNSQNNLPQITAKHQNEVKNLRQLLRKSQEKERAVSRKLRETDGELLRTKDVLQALQRLSED 256

  Fly   188 KNLDERQKLQEKLKSLEQRLEEKDNDMKLMARKVQLESKNIRQQLLNEQRKGKEVMLKLEKAKLE 252
            |||.||::|.::|..|..::|..|..::.:.::::|.:::..:||..|.||........:..:.|
Mouse   257 KNLAEREELTDRLTDLTAKMEANDKKIQNLEKQLRLNNRSYSRQLAKENRKTLAAQTATKTLQAE 321

  Fly   253 ISGY--------RKLEEYTLGTDKVNPLSSGRRTKLSGVTDEPD--KIDKLEKSMEMLDKAIEK- 306
            :...        |:||...:.|:::          |..:.|:.|  |:.. .||::...|::.. 
Mouse   322 VRQLQQKLKEKDRELEIKNIYTNRI----------LKNLNDKEDYPKVSS-TKSVQADRKSLPSV 375

  Fly   307 NNQSEFTALTDVMESESFYDFEKDSAEDKSGPNTPPSQIERQVGGRGG----------------- 354
            |.:.:.|..:||                       |..|.:...|:|.                 
Mouse   376 NMRHQETQKSDV-----------------------PFWITKGKRGKGNIAHKEKSTETNHDIPYY 417

  Fly   355 --KLILPPATNHAKMGQKANRSTLSQVLSAQGKISVSSGKSAKSRIAVAVPKMES----VQVSK- 412
              ||   |....:|...:||.:.|..:.|.    ..|.|..|..:|.....:..|    ..:|| 
Mouse   418 VCKL---PKQEESKRKYEANLTVLKSMPSP----PASWGLVATEQICAFHLECHSCTHTADLSKE 475

  Fly   413 --RREPETVSRLASAETKPKQKPLEYEYEDDYEPAGEDGDDDAYGMMSKMCEGEEPQDNSE--EN 473
              .|:|:|     |.||..:.|..:.:.|....||                |.|.....||  ::
Mouse   476 VEHRKPQT-----SLETPRRPKENKEDQEKRAIPA----------------EAEPTAKESEAHKD 519

  Fly   474 ANESSLLKYSAYMDNKSSEGDPLEE----------SMEEYDGTDGQQSQGSDDEDI---SVRAPR 525
            |.:.:|.:.:....:....||...:          ..:|..|  .|:..|:|:.|.   :..|||
Mouse   520 AEDKALTRAAGNAGDAGDAGDAGNDREVVGEHKVVGAQEVVG--AQELPGADEADEVHGAGEAPR 582

  Fly   526 LKENMSSLRKQISNDFKERESF------LKTFCRQASNS---NMRDDSASKKRN----------- 570
            ..|.....||.....:...|:.      |.|.|||.|.|   ..|.|....:..           
Mouse   583 DVEPGRGRRKTPRKHYSFTEATENLHHGLPTSCRQVSGSPHCRCRHDMGKHRSEQELRLEPAGYE 647

  Fly   571 -SIATGAAASSHMTG------SRKNALLAAL 594
             |...||.|.:....      .||::|:..|
Mouse   648 PSFGKGAGARARARARATAFRDRKSSLMEEL 678

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6652NP_648946.3 Lebercilin 82..257 CDD:292252 47/183 (26%)
GBP_C <151..252 CDD:303769 26/101 (26%)
coiled coil 239..250 CDD:293879 0/11 (0%)
Lca5lNP_001001492.2 Lebercilin 151..330 CDD:292252 47/179 (26%)
RILP-like 209..>336 CDD:304877 29/127 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C217672315
eggNOG 1 0.900 E1_28I5W
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T616927
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR16650
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.890

Return to query results.
Submit another query.