DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6652 and LCA5

Sequence 1:NP_648946.3 Gene:CG6652 FlyBaseID:FBgn0036687 Length:604 Species:Drosophila melanogaster
Sequence 2:NP_001116241.1 Gene:LCA5 HGNCID:31923 Length:697 Species:Homo sapiens

Alignment Length:653 Identity:152/654 (23%)
Similarity:266/654 (41%) Gaps:128/654 (20%)


  Fly    21 NNLMAASAKSCESLFSASSRESASLIYQRSKPPPPQ---QRGGVKGSGSMSSQNHSEIH------ 76
            ::|:::|..|..............:.:|..:.|.|:   .|.||:......|.|...:.      
Human    36 SSLVSSSPASVRRKNPKRQTSDGQVHHQAPRKPSPKGLPNRKGVRVGFRSQSLNREPLRKDTDLV 100

  Fly    77 -QRVMSARNLRAKTFQNQLADAQAEIANLAHENRMLRTLHNRQSSALNKYEAHNAELPKLLSSHA 140
             :|::|||.|:....||::::.|.::|.|..||:.|:.|..||..||||:|....|:.:|:..|.
Human   101 TKRILSARLLKINELQNEVSELQVKLAELLKENKSLKRLQYRQEKALNKFEDAENEISQLIFRHN 165

  Fly   141 EELRMWQTKYRKLQAANKALELKLKQKEEIILTLSDQNKHYSQLNKDKNLDERQKLQEKLKSLEQ 205
            .|:...:.:.||.|...:|.|.::|..|..:.......:...::::.::|.||..|.:||.|.|.
Human   166 NEITALKERLRKSQEKERATEKRVKDTESELFRTKFSLQKLKEISEARHLPERDDLAKKLVSAEL 230

  Fly   206 RLEEKDNDMKLMARKVQLESKNIRQQLLNEQRKGKEV-----MLKLEKAKLEISGYRKLEEYTLG 265
            :|::.:..:|.:::.::|.:.:.::|||.|:::..|.     :|:.|..:|    |.||:|....
Human   231 KLDDTERRIKELSKNLELSTNSFQRQLLAERKRAYEAHDENKVLQKEVQRL----YHKLKEKERE 291

  Fly   266 TDKVNPLSSGRRTKLSGVTDEPDKIDKLEKSMEMLDKAIEKNN--QSEFTAL----TDVMESESF 324
            .| :..:.|.|..|.|     |:|    ||.:     |:.||.  ||:|..|    ...||    
Human   292 LD-IKNIYSNRLPKSS-----PNK----EKEL-----ALRKNAACQSDFADLCTKGVQTME---- 337

  Fly   325 YDFEKDSAEDKSGPNTPPS-QIERQVGGRGGKLILPPATNHAKMGQKANRSTLSQVLSAQGKISV 388
             ||:.:..     |.||.: ..........|.|.|.  ....|..:......|:.::..:.|...
Human   338 -DFKPEEY-----PLTPETIMCYENKWEEPGHLTLD--LQSQKQDRHGEAGILNPIMEREEKFVT 394

  Fly   389 SSGKSAKSRIAVAVPKMESVQVSKRREPETVSRLASAETKPKQKPLEYEYEDDYEPAGEDGDDDA 453
            .      ..:.|...::|.::....||          |...|||......|.:.:|..|.|   .
Human   395 D------EELHVVKQEVEKLEDEWERE----------ELDKKQKEKASLLEREEKPEWETG---R 440

  Fly   454 Y--GM-----MSKMCEGEEPQ-----------DNSEENANESSLLKYSA---YMDNKSSEGDPLE 497
            |  ||     |.|: :|||.:           :..:....:|..|||..   ..|.:|....| |
Human   441 YQLGMYPIQNMDKL-QGEEEERLKREMLLAKLNEIDRELQDSRNLKYPVLPLLPDFESKLHSP-E 503

  Fly   498 ESMEEYDGTDGQQS--QGSDDEDISVRAPRLK-ENMSSLR--------------------KQISN 539
            .|.:.|..::..:.  .|...:|||...|:.: :|..::|                    .:.||
Human   504 RSPKTYRFSESSERLFNGHHLQDISFSTPKGEGQNSGNVRSPASPNEFAFGSYVPSFAKTSERSN 568

  Fly   540 DFKERESFLKTFCRQASNSNMRD-----DSASKKRNSIAT--GAAASSHMT--GSRKNALLAALK 595
            .|.::.||| .|.|.:.....:|     ....||.|.:..  ||:.||.::  .|..|::.::..
Human   569 PFSQKSSFL-DFQRNSMEKLSKDGVDLITRKEKKANLMEQLFGASGSSTISSKSSDPNSVASSKG 632

  Fly   596 TID 598
            .||
Human   633 DID 635

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6652NP_648946.3 Lebercilin 82..257 CDD:292252 50/180 (28%)
GBP_C <151..252 CDD:303769 26/106 (25%)
coiled coil 239..250 CDD:293879 3/16 (19%)
LCA5NP_001116241.1 Neuromodulin_N <90..482 CDD:331332 105/443 (24%)
Lebercilin 107..286 CDD:317931 52/183 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C217668942
eggNOG 1 0.900 E1_28I5W
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005917
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_137260
Panther 1 1.100 O PTHR16650
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5200
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.