DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6652 and LOC100497171

Sequence 1:NP_648946.3 Gene:CG6652 FlyBaseID:FBgn0036687 Length:604 Species:Drosophila melanogaster
Sequence 2:XP_002937268.1 Gene:LOC100497171 ID: Length:678 Species:Xenopus tropicalis

Alignment Length:709 Identity:157/710 (22%)
Similarity:279/710 (39%) Gaps:161/710 (23%)


  Fly     5 RKLASSYGPRVSQSEPN----------NLMAASAKSCESLFSASS---------RESASLIYQRS 50
            |.....|..|.|..:.|          |....|.:| .|..|.||         |.|..|..|.|
 Frog    11 RNKREDYQDRSSDGDKNSDSYYSDDYENTTYRSDRS-PSFMSRSSQAKKLGHKMRSSTPLHNQAS 74

  Fly    51 KPPP---PQQRGGVK-GSGSMSSQNHSE------IHQRVMSARNLRAKTFQNQLADAQAEIANLA 105
            ....   |.::||.| |..|.|....|.      :.:||:|||.|:....:|::.:.|.::....
 Frog    75 NKVGSKFPSRKGGAKWGFRSQSLNKESPPKDIALVTKRVLSARLLKINELRNEIRELQIKLEQHQ 139

  Fly   106 HENRMLRTLHNRQSSALNKYEAHNAELPKLLSSHAEELRMWQTKYRKLQAANKALELKLKQKEEI 170
            .||::|:.|..||..|||::|...:|:.:|:|.|..|.|..:...||.|...:..|.:||:.|:.
 Frog   140 KENKILKKLQFRQEKALNRFEDTESEISQLISRHNNETRALKEHLRKSQERERNTEKRLKEAEDE 204

  Fly   171 ILTLSDQNKHYSQLNKDKNLDERQKLQEKLKSLEQRLEEKDNDMKLMARKVQLESKNIRQQLL-- 233
            :...:...|...||:::::|.||::|.:||...|.:|:|::..::.:.:|:::...:.::||:  
 Frog   205 LYRANSTVKKLKQLSENQHLGEREELAKKLDITETKLDEQERRVQDLEKKLEITQNSFQRQLMVE 269

  Fly   234 -----NEQRKGKEVMLKLEKA--KLE----------ISGYRKLEEYTLGTDKVNP--------LS 273
                 |.|.:.|.::.:|:|.  ||:          |..||..:.......::||        :|
 Frog   270 KKKIQNAQEENKMLLEELQKLTYKLKEKERELDVKNIYAYRLSKPSPKKDAEINPRWKEARNTIS 334

  Fly   274 SGRRT-------KLSGVTDEPDKI---DKLEKSMEML---DKAIEKNNQSEFTALTDVMESESFY 325
            :|.:|       ::|.::.....|   |..||..|:|   .|..||..:.|...|....|.|.  
 Frog   335 TGVQTTAHISLVEISSLSHPTPAIPGEDVKEKQHELLQMKQKDYEKQLREEAEKLRKHKELEE-- 397

  Fly   326 DFEKDSAEDKSGPNTPPSQIERQVGGRGGKLILPPATNHAKMGQKANRSTLSQVLSAQ------G 384
              .|...|.|.     ..|.|:::.....|          ||.::..:..|.:.....      |
 Frog   398 --RKREEEQKQ-----QRQEEQRILEEKAK----------KMREEWEKEELERKRRENFYQDKIG 445

  Fly   385 KISVSSGKSAKSRIAVAVPKMESVQVSKRRE---------PETVSRLASAETKPKQKPLEYEYED 440
            |.::...:..:.:..:.:.||.  ::.|..|         ..|.:.|:.:..|.:.|..:::...
 Frog   446 KQNIQGAEDERLKKELLLAKMN--EIDKESENTMHFDSLKSHTQTLLSDSSLKHETKETKHKIYK 508

  Fly   441 DYEPAGE-------DGDDDAYGMMSKMCEGEEPQDNSEENANESSLLKYSAYMDN--KSSEGDPL 496
            ..||...       .|..:|      .....||:..:|:..|..:.:.:.:|..:  |:..|.|:
 Frog   509 FTEPTQNLFSGIPVQGGREA------SLAANEPKVTNEKRFNNVNDVSFGSYAPSFAKTRSGGPV 567

  Fly   497 --EESMEEYD---------GTDG-----QQSQGSDDEDISVRAPRLKENMSSLRKQISNDF---- 541
              .|.:||.|         .||.     :|..|.|.     .||...::..|:.|..|...    
 Frog   568 LKTEILEEPDIINHSKFNMHTDKKSNLMEQLFGKDS-----NAPVRPKSSDSIAKNESKSIFPLE 627

  Fly   542 KERESFLKTFCRQASNSNMRDDSASKKRNSIATGAAASSHMTGSRKNALLAALKTIDDN 600
            |..:..:|.:.......|::    ..:.|        |.:|||   |..:.||.:::|:
 Frog   628 KGGDVKIKNYFFSGDGKNVK----PTRHN--------SQYMTG---NQSVKALDSLEDD 671

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6652NP_648946.3 Lebercilin 82..257 CDD:292252 52/194 (27%)
GBP_C <151..252 CDD:303769 29/110 (26%)
coiled coil 239..250 CDD:293879 3/13 (23%)
LOC100497171XP_002937268.1 Lebercilin 116..295 CDD:292252 50/179 (28%)
TelA 120..>276 CDD:283473 41/156 (26%)
RILP-like <123..186 CDD:304877 19/63 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005917
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.