DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG6652 and lca5

Sequence 1:NP_648946.3 Gene:CG6652 FlyBaseID:FBgn0036687 Length:604 Species:Drosophila melanogaster
Sequence 2:XP_009295281.2 Gene:lca5 ZFINID:ZDB-GENE-090313-268 Length:767 Species:Danio rerio

Alignment Length:629 Identity:143/630 (23%)
Similarity:258/630 (41%) Gaps:116/630 (18%)


  Fly     3 SPRKLASSYGPRVSQSEPNNLMAASAKSCESLFSASSRESASLIYQRSKPPPPQQRGGVKGSGSM 67
            |.|.|:.|..|...:...:..:::|......:...:||...|..:.      ||||.|...|.|:
Zfish    84 SDRSLSPSASPSPPRRGRSRRVSSSPLHKTGVHKGASRRILSHSHH------PQQRAGAIRSQSL 142

  Fly    68 S----SQNHSEIHQRVMSARNLRAKTFQNQLADAQAEIANLAHENRMLRTLHNRQSSALNKYEAH 128
            |    |::..::.:|::|||.|:....:|.|::.:.....|..|||:||.|..||..||::|...
Zfish   143 SKDAPSKDVDQVTKRMLSARLLKINELKNALSELRLHADELQRENRLLRQLQLRQEKALHRYNDT 207

  Fly   129 NAELPKLLSSHAEELRMWQTKYRKLQAANKALELKLKQKEEIILTLSDQNKHYSQLNKDKNLDER 193
            ::|:.:||:.|..|..:.:.:.|:.|...:..|..|::::..:.....|.:...||..|:||.||
Zfish   208 DSEISQLLARHNNETHVLRERLRRSQENQRTAERSLRERDAQLQRCRSQMQKLQQLADDQNLGER 272

  Fly   194 QKLQEKLKSLEQRLEEKDNDMKLMARKVQLESKNIRQQLLNEQRKGKEVMLKLEKAKLEISGY-- 256
            ::|..||...:.||::.::.:|.:.:.::|.|.:.::||.||:||..:...:::..:.|:...  
Zfish   273 EELSRKLIGTQSRLQDSEHRVKELEKNMELSSGSFQRQLANERRKTHDAQQEVKALQEEVERLCT 337

  Fly   257 ------RKLEEYTLGTDKVNPLSS------GRRTKLSGVTDEPDKIDKLEKSMEMLDKAIEKNNQ 309
                  |:|:...:..::::..||      |.:.|...:|.        .|:::..|:....:..
Zfish   338 KLKEKERELDARNIYANRMHKASSRKEAENGSKRKGFNITS--------TKAVQTEDRTSSLDFP 394

  Fly   310 SEFTALTDVMESESFYDFEKDSAEDKSGPNTPPSQIERQVGGRGGKLILPPATNH--AKMGQKAN 372
            |...|||:                     |.||   :.|........:..|..||  .|..|::.
Zfish   395 SPPPALTN---------------------NLPP---DDQTDDYLSLKVQKPTVNHRVKKQDQQSR 435

  Fly   373 RSTLSQVLSAQGKISVSSGKSAKSRIAVAVPKMESVQVSKRREPETVSR-------LASAETKPK 430
            .....:  |.:.||.....:..|.|      .|||.: .:.:|.||:..       |...|.:..
Zfish   436 EHRTRE--SKEWKIQEFWREREKER------HMESAR-EQEKEKETLHERERQTELLKDVERQRL 491

  Fly   431 QKPL---EYEYEDDYEPAGEDGDDDAYGMMSKMCEGE-----------------EPQDNSEENAN 475
            .:.|   |..::.:......:.:|...||.....|.|                 |.||.::|...
Zfish   492 DQDLSSNEKNFKGNRVGLNREEEDRRIGMSVSQKEEEIQKQRELEEEQQKVRNREIQDYNQERVE 556

  Fly   476 ESSLLKYSAYMDNKSSEGDPLEESMEEYD-GTDGQQSQGSDDEDISVRA-PRLKENMSSLRKQIS 538
            |....|            :.|...|.|.| .|.||.|....|:..|||: |||.|     ::..:
Zfish   557 EERQRK------------EQLLAKMREIDIQTQGQDSDFFSDDTGSVRSPPRLSE-----QRNHN 604

  Fly   539 NDFK--ERESFLKTFCRQASNSNMRDDSASKKRNSIATGAAASS 580
            ..||  |.:..:.||.......::|..:.::..: :|.|:.|.|
Zfish   605 GFFKLTEPDENINTFSSGRRGGSLRAQAPNEDLD-LAFGSYAPS 647

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG6652NP_648946.3 Lebercilin 82..257 CDD:292252 49/183 (27%)
GBP_C <151..252 CDD:303769 26/101 (26%)
coiled coil 239..250 CDD:293879 0/11 (0%)
lca5XP_009295281.2 Neuromodulin_N <143..566 CDD:331332 102/476 (21%)
Lebercilin 161..340 CDD:317931 49/179 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C217669549
eggNOG 1 0.900 E1_28I5W
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005917
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR16650
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5200
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
76.830

Return to query results.
Submit another query.