DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Exn and Arhgef26

Sequence 1:NP_001097630.2 Gene:Exn FlyBaseID:FBgn0261547 Length:2029 Species:Drosophila melanogaster
Sequence 2:NP_001074764.1 Gene:Arhgef26 MGIID:1918053 Length:869 Species:Mus musculus

Alignment Length:984 Identity:266/985 (27%)
Similarity:404/985 (41%) Gaps:233/985 (24%)


  Fly  1098 SDHYYETLSPLGNKRHSTQLVRQSQDG--NRSGGVRSSHRRSKNHSASAHTLGEHVVISDDYDSF 1160
            :|...|.|:.|...:...::.....|.  :||..:.|:|||...:.                   
Mouse    48 TDFPVEELAALPTPQTPVRVPADPDDRTVSRSPQLLSAHRRPVTNG------------------- 93

  Fly  1161 ETDSDDHGDGEPDLRQRNYNDSGVDMRNHRLPKPPPPQNQVYEFVRKFKDFISSKKSPKGSQQKL 1225
            .|.|.|:....|.||:               ||.|            ...:.:|..|||.:.   
Mouse    94 RTVSPDYRAASPRLRR---------------PKSP------------LVSYAASGGSPKSTS--- 128

  Fly  1226 YENTPASTLFYVECSKRTEDV-------YENTDFGPERIPAPETKGPVHQ--EQAPVLRAKQKNG 1281
             ..|.||....:..:.||.|.       .:.|.....::.:|...|..|:  ...||.:..|..|
Mouse   129 -NGTVASPAALLSRASRTPDTPASCATDEDCTGVTASKVSSPIANGLAHKTDSSGPVSQTGQPAG 192

  Fly  1282 KSLRSRLRKSLVGSSFDTKQLSSLAPTRSTFYVEDPEGSLPALPLEPEIHGSGELDSGFSDKNCT 1346
            .                    ..|||:|.:          ||||     |.|.|        ...
Mouse   193 D--------------------LELAPSRLS----------PALP-----HKSSE--------QKL 214

  Fly  1347 PLPETPKFSTVARKAKKEAKANRRRTTIGLRPNDPPPP--------PPPMTGNKSPLDPE---RE 1400
            ||...|.                       :.|:.|.|        |..:...|..:.|:   .|
Mouse   215 PLQRLPS-----------------------QGNELPNPSVVLSTNSPAALKMGKQQIIPKSLASE 256

  Fly  1401 LDAEQTTSWYAECGVFKQATNGAVSPRGDEPVTPTPSGHGGVSSWYAESGLYQTSGISVAS-SSG 1464
            :...::.|...|...........|...|      .|.||.|      |.|.......|..| ..|
Mouse   257 IKLSKSNSQNVESHRRLLKVRSMVEGLG------APLGHEG------EEGEVDNDMDSPGSLRRG 309

  Fly  1465 SSGVSTGNEAGLGDELSSEPHSLFSN---EPLYQ--MYSAAKLESITR----DLEAHGSSDG--- 1517
            ....|.......|.:..|...|...|   :|:.:  |....|..|:.|    .|:..|:.||   
Mouse   310 LRSTSYRRAVVSGFDFDSPTSSKKKNRMSQPVLKAVMEDKEKFSSLGRIKKKILKGQGTFDGEEN 374

  Fly  1518 ------YEEIGLQAKAKPEPLVKPRPTALQLVEPKNGPSRTLWSEIPEVIHSCILPTLTSRERSL 1576
                  |:|..|...:..||..|.:....::| ..:.|.|:.||::..|..:.:..|::..||..
Mouse   375 AVLYQNYKEKALDIDSDEEPEAKEQKAEERIV-IHHKPLRSTWSQLSAVKRNGLSQTVSQEERKR 438

  Fly  1577 QEAKFEIITSEASYLKSLNLLRRHFMNHNAFLDSSVLSAKDRKALFSYIVPVHECSERLLTELEA 1641
            |||.||:|:||.|||.||.:|.|.|.|.....|:  ::..:|..|||.|..|.|.|::..|||||
Mouse   439 QEAIFEVISSEHSYLLSLEILIRMFKNSKELTDT--MTKTERHHLFSNITDVWEASKKFFTELEA 501

  Fly  1642 CWQDNIMLLGLSRCIYEIAERH----FHVYVAFCEHQGRMDRTLRRLKESKESLAFQQHLERLEA 1702
            ..|:||.:..:|    :|.|:|    |..||.:|.::....|||::|..:..|  |::.|.|:|:
Mouse   502 RHQNNIFIEDIS----DIVEKHTASTFDPYVKYCTNEVYQQRTLQKLLATNPS--FKEVLSRIES 560

  Fly  1703 SPSCCGLNLHSFLMLPMQRITRLPLLIDAVFSKESPLNREEYESWKLTLALVQKVVGQCNEAANR 1767
            ...|..|.:.|||:|||||:||||||:|.:..| :|.:..:||..|..|..|.|:|..|||.|.:
Mouse   561 HEDCRNLPMISFLILPMQRVTRLPLLMDTICQK-TPKDSPKYEVCKRALKEVSKLVRLCNEGARK 624

  Fly  1768 WEQAFELERIARQLEFPSHVRALAIAPVGVPRAGAKPRFLVKRGELTHLLWRGEDAKLTFGKRLT 1832
            .|:...:..|..||||       .|.|..:.   :..|:||||||||..:   ||..| |.||::
Mouse   625 MERTEMMYTINSQLEF-------KIKPFPLV---SSSRWLVKRGELTAYV---EDTVL-FSKRMS 675

  Fly  1833 KISIYAFLFSDLLLLCKRRGESCFSVFDYCPRSMLTLAAGDSLPQLPTKDLKDQAGKN------- 1890
            |..:|.|||:|:|::.|::.|..::|.||..|..|.:.:.|:      ::|....|||       
Mouse   676 KQQVYFFLFNDVLIITKKKSEESYNVNDYSLRDQLLVESCDN------EELNSSPGKNPSTMLYS 734

  Fly  1891 -------LILMTLLENCDRKTVELVLSCPSVSDQQRWLQAM------RPPEAETPGEKLYESWDC 1942
                   |..:|:|.|...:.|:::|...:.|::.||:.|:      :||:..|          .
Mouse   735 RQSSATHLFTLTVLSNHASEKVDMLLGAETQSERARWITALGHSSGKQPPDRTT----------L 789

  Fly  1943 PQVVAKHSYESDEPDVLQLELGDVVNVSRKLPDGWYQGERIRDGAVGWFPGSYTEELNSAHVRAR 2007
            .||....|:.:.:||.|.|::.|||.:.:::.||||:|||:|||..||||....:|:.......:
Mouse   790 TQVEIIRSFTAKQPDELSLQVADVVLIYQRVGDGWYEGERLRDGERGWFPMECAKEITCQATIDK 854

  Fly  2008 NLKQRHRLL 2016
            |:::..|||
Mouse   855 NVERMGRLL 863

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ExnNP_001097630.2 RhoGEF 1581..1763 CDD:279015 76/186 (41%)
PH_ephexin 1805..1931 CDD:269929 46/146 (32%)
SH3_ephexin1_like 1944..1998 CDD:212727 24/54 (44%)
Arhgef26NP_001074764.1 RhoGEF 441..620 CDD:279015 77/188 (41%)
PH_ephexin 641..779 CDD:269929 46/151 (30%)
SH3_ARHGEF16_26 791..845 CDD:212871 24/54 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5422
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T616925
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12845
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3601
TreeFam 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.