DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Exn and ngef

Sequence 1:NP_001097630.2 Gene:Exn FlyBaseID:FBgn0261547 Length:2029 Species:Drosophila melanogaster
Sequence 2:XP_697546.3 Gene:ngef ZFINID:ZDB-GENE-130530-794 Length:718 Species:Danio rerio

Alignment Length:788 Identity:236/789 (30%)
Similarity:347/789 (44%) Gaps:155/789 (20%)


  Fly  1256 RIPAPETKGPVHQEQAPVLRAK-QKNGKSLRSRLRKSLVGSSFDTKQLSSLAPTRSTFYVEDPEG 1319
            |.|.|:......:.:...|||. ::|.:..||..:|...|.|   :|..|  |:.|.....||..
Zfish    26 RTPVPQLPSEDDENEDETLRAPIRRNSRFYRSMRKKKSAGPS---EQQES--PSSSPKPTVDPAS 85

  Fly  1320 ---SLPA----LPLEPEIHGSGELDSGFS---------DKNCTPLPETPKFSTVARKAKKEAKAN 1368
               ..||    :||.|.:..|....||.|         .::.:||.....:   .|:.:.|..:.
Zfish    86 YNRLSPAAANRVPLSPRLQKSPPSRSGISLLSNGVQGGVRSRSPLASPGDW---PRRLEMEELSE 147

  Fly  1369 RRRTTIGLRPNDPPPPPPPMTGNKSPLDPERELDAEQTTSWYAECGVFKQATNGAVSPRGDEPVT 1433
            |..:...::.||          |.|..||:..              .|:...|      ||.|  
Zfish   148 RTTSACTMQDND----------NHSTADPDNI--------------TFRLVRN------GDSP-- 180

  Fly  1434 PTPSGHGGVSSWYAESGLYQTSGISVASSSGSSGVSTGNEAGLGDELSSEPHSLFSN-EPLYQMY 1497
                               |...:                     |.|....::..| :.|||.|
Zfish   181 -------------------QKMAV---------------------ENSCHNLNIMKNVDVLYQEY 205

  Fly  1498 SAAKLESITRDLEAHGSSDGYEEIGLQAKAKPEPLVKPRPTALQLVEPKNGPSRTLWSEIPEVIH 1562
               :..|..::::.....||....|....|.|         ||||....:..|..||..:..|..
Zfish   206 ---RDTSKQQEIDQRRQRDGLPTAGSGVLAAP---------ALQLQLRSSTNSLNLWQNLDAVKK 258

  Fly  1563 SCILPTLTSRERSLQEAKFEIITSEASYLKSLNLLRRHFMNHNAFLDSSVLSAKDRKALFSYIVP 1627
            |.:|.||..:|..||||.||::||||||.|||.||..||:.:...:::  ||..|...|||.|..
Zfish   259 SGLLQTLEPKEIILQEAMFELVTSEASYYKSLELLETHFLRNPLLVNT--LSQSDMHFLFSNITD 321

  Fly  1628 VHECSERLLTELEACWQDNIMLLGLSRCIYEIAERHFHVYVAFCEHQGRMDRTLRRLKESKESLA 1692
            :.:.||:.|.:||...:::|::..:...::..|..||.|::::..:|...:...||:.:  |:.|
Zfish   322 IMKASEKFLMDLEHRIEESILISDVCDIVHFHAVNHFQVFISYVINQVYQETNYRRILQ--ENCA 384

  Fly  1693 FQQHLERLEASPSCCGLNLHSFLMLPMQRITRLPLLIDAVFSKESPLNREEYESWKLTLAL---- 1753
            |::::..||..|...||:..|||:||.||||||.||:..:      |.|.|..|.|...|:    
Zfish   385 FRENMAILENQPKVKGLSFTSFLILPFQRITRLKLLVQNI------LKRVEENSEKERTAILAHQ 443

  Fly  1754 -VQKVVGQCNEAANRWEQAFELERIARQLEFPSHVRALAIAPVGVPRAGAKPRFLVKRGELTHLL 1817
             ::|:|.||||.|.:..:..||..|.:.|||.|.         .|| ..:..|:|:|:||:..: 
Zfish   444 ELEKIVKQCNEGARKMSRTEELISIEKTLEFKSK---------SVP-VISHSRWLLKKGEVQQM- 497

  Fly  1818 WRGEDAKLTFGKRLTKISIYAFLFSDLLLLCKRR--GESCFSVFDYCPRSMLTLAAGDSLPQLPT 1880
             .|..:..|...|.....||.|||::|||:.||.  |:. |.|.|.|.||||.           |
Zfish   498 -SGPKSTRTMRSRKLYHPIYLFLFNNLLLITKRNSSGDK-FQVLDSCSRSMLR-----------T 549

  Fly  1881 KDLKDQAGKNL---ILMTLLENCDRKTVELVLSCPSVSDQQRWLQAMRPPEAETPGEKLYESWDC 1942
            :||:|| |:.|   .::.||||.:.:.|..:|...||||:.||:.|:.|..............|.
Zfish   550 EDLEDQ-GQMLACVFVLKLLENQEDREVSYMLKTESVSDKLRWICALTPNRRTRFLSTSTHEPDS 613

  Fly  1943 PQVVAKHSYESDEPDVLQLELGDVVNVSRKLPDGWYQGERIRDGAVGWFPGSYTEELNSAHVRAR 2007
            |||....||.|.|||.|.:|:.||:::.....|||..|||:.||..||||....|.:.||.|||:
Zfish   614 PQVQCIQSYSSQEPDELSVEMADVLHILECTDDGWILGERLHDGERGWFPNRVVERIMSAEVRAQ 678

  Fly  2008 NLKQRHRL 2015
            |||:..|:
Zfish   679 NLKECQRI 686

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ExnNP_001097630.2 RhoGEF 1581..1763 CDD:279015 67/187 (36%)
PH_ephexin 1805..1931 CDD:269929 48/131 (37%)
SH3_ephexin1_like 1944..1998 CDD:212727 25/54 (46%)
ngefXP_697546.3 RhoGEF 275..454 CDD:279015 68/189 (36%)
PH_ephexin 475..601 CDD:269929 51/151 (34%)
SH3 615..668 CDD:302595 24/53 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5422
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002249
OrthoInspector 1 1.000 T597806
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12845
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3601
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.