DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Exn and rgf2

Sequence 1:NP_001097630.2 Gene:Exn FlyBaseID:FBgn0261547 Length:2029 Species:Drosophila melanogaster
Sequence 2:NP_594853.1 Gene:rgf2 PomBaseID:SPAC1006.06 Length:1158 Species:Schizosaccharomyces pombe

Alignment Length:842 Identity:164/843 (19%)
Similarity:268/843 (32%) Gaps:283/843 (34%)


  Fly  1206 RKFKDFISSKK------------SPK--GSQQKLYEN-----TPASTLFYVECSKRTEDVYENTD 1251
            |.|..|.||:|            ||.  .|...|.||     .|||:|                .
pombe    27 RIFSSFSSSQKLFQRRSSGSITHSPTALSSTTSLNENDGNHFRPASSL----------------S 75

  Fly  1252 FGPERIPAPETKGPVHQEQAPVLRAKQKNGKSLRSRLRKSL-VGSSFDTKQLSSLA--PTRSTFY 1313
            |.|..:...:: ||     ...|...:||....||...... :..:...|::.||.  .||.:|.
pombe    76 FSPSSLSRKDS-GP-----GDGLEVNKKNNFYRRSSSTDDFGISHARSRKEIQSLGRPHTRQSFS 134

  Fly  1314 VED------------------------PEGSLPALPLEPEIHGSGELDSGFSDKNCTPLPETPKF 1354
            |.|                        ||||...| |:   |.||. .|..:..|..|   :...
pombe   135 VSDVSNGSSYPNIRKNSVHVNAPMPSFPEGSTAVL-LK---HHSGS-KSASAISNIAP---SHSN 191

  Fly  1355 STVARK-------AKKEAKANRRRTTIGLRPND-------------------------------- 1380
            ||.:|:       ..:.|...|:|..||.|..|                                
pombe   192 STSSRRPYIHPAFLSQVAVEFRKRLNIGDRVKDGLLYKDAFLGSEAVDVLMHIVRTTDRNLALLL 256

  Fly  1381 ----------------------------------PPPPPPPMTGNKSPLD-----PERELDAEQT 1406
                                              |||....|..|.|.::     .:|..:...:
pombe   257 GRALDSQKMFHDVTYSHRLRDSLKEVYQYRRIISPPPGLSSMDSNGSSIENNFLYTKRRANTSDS 321

  Fly  1407 TSWYAECGVFKQATNGAVSPRGDEPVTPTPSGHGGVSSWYAESGLYQTSGISVASSSGSSGVSTG 1471
            ..                |...|...|||.|     ||....|..:.||.:|..:....:     
pombe   322 FD----------------SVLSDSSTTPTIS-----SSVQVNSLAFITSSLSAITKEPEA----- 360

  Fly  1472 NEAGLGDELSSEPHSLFS------------NEPLYQMYSAAKLESITRDLEAHGSSDGYEEIGLQ 1524
                  .|....||.:|:            |...|.:....:||...|                 
pombe   361 ------PETEYNPHGVFTLLTECYSSTCSRNRLCYSISCPRRLEQQAR----------------- 402

  Fly  1525 AKAKPEPLVKPRPTALQLVEPKNGPSRTLWSE-IPEVIHSCILPTLTSRERSLQEAKFEIITSEA 1588
            ...|.:|::....|:   :..|......|||| :|:.    ::..:..||...||..||:|.:|.
pombe   403 LHLKVQPVLSGGSTS---ITDKQEEDHRLWSENVPKQ----VVDQIDVREWKRQEIIFEVIYTER 460

  Fly  1589 SYLKSLNLLRRHFMNHNAFLDSSVLSAKDR----KALFSYIVPVHECSERLLTELEACWQDNIML 1649
            .:::.|..:|..::  .....|:|:...:|    :.:|..|:.:|..:.||...|........::
pombe   461 DFVRDLEYIRDFWI--KPLSTSNVIPENNRQQFIRCVFHNIMQIHAVNSRLSNALNRTQTLQPVV 523

  Fly  1650 LGLSRCIYEIAERHFHVYVAFCEHQGRMDRTLRRLKESKESLAFQQH-LERLEASPSCCGLNLHS 1713
            ..:.....:...: |..::.:..:|........|.|.:..:.|...| :|||..|..   |.|:.
pombe   524 NTIGDLFLDYVPK-FEPFIKYGANQAIAKFEFEREKSTNRNFANYVHEVERLRESRK---LELNG 584

  Fly  1714 FLMLPMQRITRLPLLIDAVF---SKESPLNREEYESWKLTLALVQKVVGQCNEAANRWEQAFELE 1775
            :|..|..|:.|.|||:..|.   .|::|    :.|:....:.::::.:.:.|....:.|....|.
pombe   585 YLTKPTTRLARYPLLLSGVLKYTDKDNP----DTENIPRVIEMIREFLTKLNYETGKTENRLSLL 645

  Fly  1776 RIARQLEFPSHVRALAIAPVGVPRAGAK------PRFLVKRGELTHLLWRGEDAKL---TFGKRL 1831
            ::..||...             |...||      .|.|:.:|.:          ||   ::....
pombe   646 QLNEQLSCS-------------PADRAKLTLFDPSRLLIFKGVV----------KLKASSYSNGD 687

  Fly  1832 TKISIYAFLFSDLLLLCKRRGESCFSVFDY----CPRSMLTLA------AGDSLPQLPTKDL 1883
            |:..|:.||..:.|||||.:.:....|...    .|..:|:::      :..|||:.|:..|
pombe   688 TENDIHMFLLDNFLLLCKIKIQMKRRVHKLHLRPLPLELLSISYIEDSPSRGSLPRRPSSAL 749

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ExnNP_001097630.2 RhoGEF 1581..1763 CDD:279015 39/190 (21%)
PH_ephexin 1805..1931 CDD:269929 22/93 (24%)
SH3_ephexin1_like 1944..1998 CDD:212727
rgf2NP_594853.1 ROM1 1..1148 CDD:227709 164/843 (19%)
DEP_fRom2 204..285 CDD:239882 7/81 (9%)
RhoGEF 451..632 CDD:279015 38/191 (20%)
PH_5 670..802 CDD:292048 21/91 (23%)
CNH 831..1117 CDD:279162
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3601
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.