DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Exn and akap13

Sequence 1:NP_001097630.2 Gene:Exn FlyBaseID:FBgn0261547 Length:2029 Species:Drosophila melanogaster
Sequence 2:XP_021327529.1 Gene:akap13 ID: Length:1416 Species:Danio rerio

Alignment Length:1452 Identity:275/1453 (19%)
Similarity:461/1453 (32%) Gaps:535/1453 (37%)


  Fly    61 DSENNNRATCDKAGKDNPNPNQNPNSQANPNQNC------------SCESRA------------- 100
            :.|.|.|::...||:..|...:...|.. |::.|            |.|..|             
Zfish   175 EEEMNQRSSVQNAGEGKPVFYRRSLSWC-PSEPCPELEEIRKLISYSLEGLAAGIEDGKRWRSGA 238

  Fly   101 -FRDFRGVQTLRLLWSRRIKSASED-----------------QCHSP-------VHCHTSSSSLG 140
             .:|.||||          :..|||                 :|.||       .|...:|||..
Zfish   239 PSKDQRGVQ----------RQDSEDRGSLMSLTEEGPESDLGECRSPGIQKSRKYHQFRNSSSSV 293

  Fly   141 TLKKLNKSVSCLVNAFNNSRDCATPEKTLAKRAASL-HNLQDSQAKHKQL-------HREKD--- 194
            || .|.||||.|   ..:.||.....:...||..|. .||.....|.|.:       ..|:|   
Zfish   294 TL-PLTKSVSML---SISQRDLDAIGRIRRKRRISFTFNLSPILPKSKSVITVSSSSSDEEDIIS 354

  Fly   195 -----------------------------------NFYKYKNAEQAKMQAKLRSSADEAILNASE 224
                                               .|...||    ||..|.|....|.  |..:
Zfish   355 MTSFSTAGNMGYSITEEEPGPLRGDFEKSSTKVSRTFSYLKN----KMYKKAREKEKEK--NREK 413

  Fly   225 TR-AKRDDSGCLPGVKSYNSKALSAADKVAKVAKGEAKTQRRAEEPVGEAEVEVEVEFRAKREH- 287
            .| ||..:.      ||.|....:|.:.:......:.......::.|......:.|. ::.||: 
Zfish   414 DREAKEREK------KSVNGHLFTAVNSLHPALCQQCNKTLNTKDAVHCTNCNIRVH-KSCRENI 471

  Fly   288 -----NRLEGLSLSAASAQSGGSSESLQTTTTSSST-----------PTTHSSV----------- 325
                 :|::..::..::..      .:.|..|.|||           |..||.:           
Zfish   472 PICLKSRMKQFAIPESTTM------PVVTLRTKSSTLRERPWSAIFSPEEHSVIIPSRRPTSIMP 530

  Fly   326 --TSSTGRS--------------GGRRKYSFKTHAGKSYHQHHHPSRRTSNMDSSNGGISMV-AK 373
              :|:..:|              .|||      :..:|....|.|::.|::.:|.:.|..|| ::
Zfish   531 FHSSNLSKSMSINNIAMFDDMPLSGRR------YLSQSTDSLHKPNKVTASNESLDEGTEMVDSR 589

  Fly   374 LTHQFNEIIQK----------DAKLLEQVKRNNGVWISRGTHVYKIVE----------------- 411
            |...|...:::          |.|.|:|:|::   .|.|...:|::::                 
Zfish   590 LMGDFEADVKELEADSWSLIVDKKYLKQLKKD---IIKRQDVIYELIQTEMHHLRTLRIMCDVYS 651

  Fly   412 ---------KPTSEGKGLPNADD-----------------------------NRISTVQRNIKKF 438
                     :|.:..|..|..||                             :||..:.  :.:|
Zfish   652 KGLLMDLQLEPQAVEKMFPMLDDLLELHSFFFSALLERKKEARLDGTDGFLIHRIGDLL--VSQF 714

  Fly   439 ERLEKPSVPLKSEQLMRKHLELMR--GSSLSRGPRIKRNLKLPPGS-----VGIPE-LAIVSEEL 495
            ......|:.....:...:|.|.:.  ....:|..|.:..::....|     :.||| :.:|::.:
Zfish   715 SDSNAESMKRIYGKFCSRHNEAVNFYKDLHARDKRFQAFIRKKMSSSVVRRLSIPECILLVTQRI 779

  Fly   496 KTPTSEEQAKKPKSVQNESQPNHPEELNQSNDKPSDEL--------DLIMGEEGDEEELRQKQRK 552
                    .|.|..:|...|  |.:|    |:|..::|        |:|...   :.::.:.::|
Zfish   780 --------TKYPVLLQRILQ--HTKE----NEKDFEDLTQAFQLLKDIIASV---DSKVNEHEKK 827

  Fly   553 HKYASIYEKLRFTFAKGRKSASPSPTKAQIREEVSIDEESIKDSTSEDMVTRKE---------DF 608
            .|...||         ||                 .|.:||....|..|..|::         |.
Zfish   828 KKLKEIY---------GR-----------------TDSKSITRMKSGQMFAREDLVRGRRLLHDG 866

  Fly   609 TLDLPKEVIPRAEDLEDSSHALLVSPCF----EADAKILDALEAVDLKLKV--LNPLNDVTTADG 667
            .|.| |....|.:|:    ||||:|...    |.|.|.:.|  ::|.:..|  |..|.....|..
Zfish   867 PLQL-KNTAGRLKDV----HALLLSDVLVFLQEKDQKYVFA--SLDQRATVISLQKLIVREVAHE 924

  Fly   668 ERELLL----AANDDFEQRILPNSSFVYQAANKQYSNNQILLNQAVNVTLVNAIEGEQMIMEQKQ 728
            ||.|.|    .||        |....|:.::.::.:....::..|::....:..||.....|:.:
Zfish   925 ERGLFLITAGIAN--------PEMVEVHASSREERNTWMQIIQDAMHSIEKDDDEGIPSETEEDR 981

  Fly   729 LMKVRDLELTERDIDQPLKRAEKSPEKDD-----TLEPESLYEPITPVMDETKTEAQTSSLFKIY 788
            .:    ||...|::.:.|:|      ||:     .||...::..    |..:..:.|...||:..
Zfish   982 KL----LETKTREMREMLQR------KDEQIVSLLLEKMKIFRE----MCGSSEDPQVKMLFRAN 1032

  Fly   789 TKKSELVEDIY-QTVEEASTVEVKPNNWLEGYESIAGSQEACPLTYDGYESFAPEEVVTTPTTPS 852
            .::....|.|. ..:.|...::...|:.|.|   ..|.|.||                       
Zfish  1033 NEEVAKGEPIMTDALREVEMLQALVNSSLGG---AVGQQVAC----------------------- 1071

  Fly   853 ATGTLGRNTRDELPELPKPKRVLNKSPIPLRPAPPKPQAKESEEDENIYDTIKG--CYESMHCKA 915
            |.|.:|                    |:.|      |:..|         |..|  |::...|| 
Zfish  1072 AQGIMG--------------------PVCL------PRRAE---------TFGGFDCHQMNTCK- 1100

  Fly   916 TSSSSSGEATLTTDTISLSSNCYESISHIRRSRVATTQNQGHGSAGSCIQLSSSGSTLTISSDHK 980
                 .||.              |....:||:...:...:| |:|...:.|..:...:..|..|.
Zfish  1101 -----HGEK--------------EEAEDLRRTESDSVLKKG-GNANLLLLLKKNSEQVLTSVTHL 1145

  Fly   981 TNSLYESSLAAAGCVVYGSASV-GCRSSLGSSAGSRDSGKP-----GDKRSSIAGSSDNSDA--- 1036
            .:.|  |||.|.  |:.....: ..|.:|.....||.|.:|     .:|:.|:.....::.|   
Zfish  1146 HDLL--SSLQAV--VLQQDTFIEDQRQALSERTPSRPSSRPPSLVEQEKQRSLERHRQDAAALLR 1206

  Fly  1037 ---------------WVDISDGEIGQATTDATANEAQFIVVRERFKPHRT------------RSP 1074
                           | |:.:.|:    ||...    .:.|||.....|:            |..
Zfish  1207 QQAAHAEEKKRKEKEW-DVKEREL----TDREV----LLHVREEEVRRRSREMEEAQVQLQGRKE 1262

  Fly  1075 DWSK---RIRD-------KRLQQKKAISCIEDDSDHYYETLSPLGN----------KRHSTQLV- 1118
            |:.|   |:||       :|.|.:|.:..:|    |..|..:.|..          |.||:..: 
Zfish  1263 DYQKDLERLRDAQRKLEREREQMQKEMERVE----HLREVQARLHRTPSSTSEDSLKLHSSSSIE 1323

  Fly  1119 RQSQDGNRSGGVRS---SHRRSKNHSASAHTLGEHVVISDDYDSFET------DSDDHGDGEPDL 1174
            |::.:...|...|.   |...||..|.|..:||.....::..:...|      .|.:..|.:   
Zfish  1324 REAWESELSSSPRKNSLSRMDSKQKSRSLFSLGGKSQSTEGQNQMPTRLLQLATSKEKKDKK--- 1385

  Fly  1175 RQRNYNDSGVDMRNHRLPKPPP 1196
            ::::.:.:..|..:|.||...|
Zfish  1386 KKKSKSQTPQDAASHLLPLTEP 1407

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ExnNP_001097630.2 RhoGEF 1581..1763 CDD:279015
PH_ephexin 1805..1931 CDD:269929
SH3_ephexin1_like 1944..1998 CDD:212727
akap13XP_021327529.1 C1 428..472 CDD:197519 5/45 (11%)
RhoGEF 625..818 CDD:238091 31/212 (15%)
PH_AKAP13 862..964 CDD:275427 29/117 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5422
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.