DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: sinah and CG6688

Sequence 1:NP_648927.1 Gene:sinah FlyBaseID:FBgn0259794 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_651110.1 Gene:CG6688 FlyBaseID:FBgn0039038 Length:424 Species:Drosophila melanogaster

Alignment Length:97 Identity:34/98 (35%)
Similarity:49/98 (50%) Gaps:13/98 (13%)


  Fly    72 RKDSVAV-----------QSGIVATGPLDTT--RSGARDDFLMALLECPVCFGYIMPPIMQCPRG 123
            :||.|.:           .:..:...|:.|:  |.....:.::.|:|||||...|.||.|||..|
  Fly    97 QKDCVTILCWNSECDKDCDTNSICCAPMPTSLRRLSLVLESILRLVECPVCGVTISPPAMQCQNG 161

  Fly   124 HLICSTCRSKLTICPVCRVFMTNIRSLAMEKV 155
            ||:|..||.:...|||||.|.|..|:|..|::
  Fly   162 HLLCVDCRIRSERCPVCRDFYTPRRALLAEQI 193

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sinahNP_648927.1 zf-C3HC4 106..140 CDD:278524 19/34 (56%)
Sina 147..341 CDD:281181 3/10 (30%)
CG6688NP_651110.1 PDZ_signaling 24..104 CDD:238492 3/7 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3002
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D780610at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.