DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: sinah and Siah2

Sequence 1:NP_648927.1 Gene:sinah FlyBaseID:FBgn0259794 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_033200.2 Gene:Siah2 MGIID:108062 Length:325 Species:Mus musculus

Alignment Length:340 Identity:143/341 (42%)
Similarity:196/341 (57%) Gaps:23/341 (7%)


  Fly     6 SRPQLSWPERVSPQRTIDTPTASGEMLTRRQSAPALVVPPEETTHVVVVKRQSPDAAAAGELVPS 70
            |||..:.|....|......|       .:...||:...||...|    :....|.::|    ||:
Mouse     2 SRPSSTGPSANKPCSKQPPP-------PQTPHAPSPAAPPAAAT----ISAAGPGSSA----VPA 51

  Fly    71 RRKDSVAVQSGIVATGPLDTTRSGARDDFLMALLECPVCFGYIMPPIMQCPRGHLICSTCRSKLT 135
                :.||.||..|.|..|.......:  |.:|.||||||.|::|||:||..|||:|:.||.||:
Mouse    52 ----AAAVISGPGAGGGADPVSPQHHE--LTSLFECPVCFDYVLPPILQCQAGHLVCNQCRQKLS 110

  Fly   136 ICPVCRVFMT-NIRSLAMEKVASKLIFPCKHSHFGCRARLSYAEKTKHEEDCECRPYFCPYPDDK 199
            .||.||..:| :||:||||||||.::||||::..||...|.:.||.:||:.||.|||.||.|...
Mouse   111 CCPTCRGALTPSIRNLAMEKVASAVLFPCKYATTGCSLTLHHTEKPEHEDICEYRPYSCPCPGAS 175

  Fly   200 CSWQGPLRDVYQHLMSSHENVITMEGNDIIFLATNVNLEGALDWTMVQSCHGRHFLLSLEKINLG 264
            |.|||.|..|..|||.:|:::.|::|.||:||||::||.||:||.|:|||.|.||:|.|||....
Mouse   176 CKWQGSLEAVMSHLMHAHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGHHFMLVLEKQEKY 240

  Fly   265 EDCQQYFTACRMIGSMKDAAEFVYNISLEAYNRTLRWQSKPRSIRENF-SSFTNADFLVLNKHTV 328
            |..||:|....:||:.|.|..|.|.:.|....|.|.|::.||||.:.. ::..|:|.||.:....
Mouse   241 EGHQQFFAIVLLIGTRKQAENFAYRLELNGNRRRLTWEATPRSIHDGVAAAIMNSDCLVFDTAIA 305

  Fly   329 ELFSEDGNLALNVVI 343
            .||:::|||.:||.|
Mouse   306 HLFADNGNLGINVTI 320

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sinahNP_648927.1 zf-C3HC4 106..140 CDD:278524 21/34 (62%)
Sina 147..341 CDD:281181 92/195 (47%)
Siah2NP_033200.2 Sina 123..319 CDD:281181 93/196 (47%)
SBD. {ECO:0000250|UniProtKB:P61092} 131..323 87/191 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3002
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45877
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.960

Return to query results.
Submit another query.