DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: sinah and siah-1

Sequence 1:NP_648927.1 Gene:sinah FlyBaseID:FBgn0259794 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_500409.1 Gene:siah-1 WormBaseID:WBGene00021369 Length:419 Species:Caenorhabditis elegans

Alignment Length:348 Identity:133/349 (38%)
Similarity:191/349 (55%) Gaps:37/349 (11%)


  Fly     7 RPQLSWPERVSPQRTIDTPTASGEMLTRRQSAPALVVPPEETTHVVVVKRQSPDAAAAGELVPSR 71
            |...|.|..||   ||......|:.:.|.||.|...:|...||....::..:|.....|      
 Worm    84 RMSASPPSAVS---TISGTAVLGKTMARVQSNPPGSIPHNTTTTAQGIQSVAPHIPIGG------ 139

  Fly    72 RKDSVAVQSGIVATGPLDTTRSGARDDF---LMALLECPVCFGYIMPPIMQCPRGHLICSTCRSK 133
                                 .||.||.   ::::.|||||..|::||.|||..|||:||.||.|
 Worm   140 ---------------------GGATDDSSAEILSVFECPVCLEYMLPPYMQCSSGHLVCSNCRPK 183

  Fly   134 LTICPVCRVFMTNIRSLAMEKVASKLIFPCKHSHFGCRARLSYAEKTKHEEDCECRPYFCPYPDD 198
            |..||.||....::|:|.:||:|:.:.||||.|..||.....:|:||:|||.||.|||.||.|..
 Worm   184 LQCCPTCRGPTPSVRNLGLEKIANTVRFPCKFSTSGCPLNFHHADKTEHEELCEFRPYCCPCPGA 248

  Fly   199 KCSWQGPLRDVYQHLMSSHENVITMEGNDIIFLATNVNLEGALDWTMVQSCHGRHFLLSL---EK 260
            .|.|||.|.||.:||...|:::.|::|.||:||||::||.||:||.|:|||...:|:|.|   ||
 Worm   249 SCKWQGGLSDVMEHLKKIHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFDYNFMLVLEKQEK 313

  Fly   261 INLGEDCQQYFTACRMIGSMKDAAEFVYNISLEAYNRTLRWQSKPRSIREN-FSSFTNADFLVLN 324
            .:..:..|.::...::|||.|:|..|||.:.|.|..|.:.|::.||||.|. ..:...:|.|..:
 Worm   314 YDPAQPTQMFYAVVQLIGSKKEADNFVYRLELSASRRRMSWEATPRSIHEGVVVAIQQSDCLAFD 378

  Fly   325 KHTVELFSEDGNLALNVVIRKVE 347
            .:..:||:|:|||.:||.|.:::
 Worm   379 SNAAQLFAENGNLGINVTISRID 401

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sinahNP_648927.1 zf-C3HC4 106..140 CDD:278524 21/34 (62%)
Sina 147..341 CDD:281181 86/198 (43%)
siah-1NP_500409.1 RING 155..194 CDD:238093 24/39 (62%)
Sina 197..396 CDD:281181 87/199 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3002
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45877
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.960

Return to query results.
Submit another query.