DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Zcchc7 and ZCCHC2

Sequence 1:NP_648926.3 Gene:Zcchc7 FlyBaseID:FBgn0036668 Length:1734 Species:Drosophila melanogaster
Sequence 2:NP_060212.4 Gene:ZCCHC2 HGNCID:22916 Length:1178 Species:Homo sapiens

Alignment Length:645 Identity:123/646 (19%)
Similarity:226/646 (35%) Gaps:163/646 (25%)


  Fly     4 LEEMDSERLNELESILYASIHYSDGFEEHTAMDQPAKESTSDQDARSMPPPPQQKHPIPGQRFVS 68
            |.::||    .|:|:..|....|.|..|    |:..::...:|||......|:            
Human   195 LPQVDS----VLKSLRAARGEGSRGGAE----DERGEDGDGEQDAEKDGSGPE------------ 239

  Fly    69 GTRVINNSMQKPRYWIDGAAAVGEGQVVQAEEQQATTNKTMPAVEESSSSQSMDVDMPQDKSLLL 133
                  ..:.:||        ||.|...:|:|:.... .||.::..:.|.... |.:.:....|.
Human   240 ------GGIVEPR--------VGGGLGSRAQEELLLL-FTMASLHPAFSFHQR-VTLREHLERLR 288

  Fly   134 SPEKGTSNQPKTASQPPKHQQIPQAKQQQNIHAKQLQNQQAKPQEQKNSQQKQQQSLKQQNQQSK 198
            :..:|.....:...:|.|... |:| |..:.|...:||.::...||....|........:.|:..
Human   289 AALRGGPEDAEVEVEPCKFAG-PRA-QNNSAHGDYMQNNESSLIEQAPIPQDGLTVAPHRAQREA 351

  Fly   199 QH------QNQQKKSAPVVQKPKPQPNAS-------TKVNHEAYE----------AERFDQRLLV 240
            .|      :..|:|.|....:...:.|.|       ||.:.|..|          :|.||:.:|.
Human   352 VHIEKIMLKGVQRKRADKYWEYTFKVNWSDLSVTTVTKTHQELQEFLLKLPKELSSETFDKTILR 416

  Fly   241 AIPPNCPPKKQNKPQQNKQQQQQNKQQQKKQQQSLQHNKQQQQSGPGPFGKANRKLEQIQRLADK 305
            |:                  .|.:.::::::...|:...:|.      |..:::...|.|::...
Human   417 AL------------------NQGSLKREERRHPDLEPILRQL------FSSSSQAFLQSQKVHSF 457

  Fly   306 KQKSKQAQLNKKQRKQQSPPVEFV--NLAETSE--SSDDDDVVHVPL------PPAPII-ELDTS 359
            .|......|:.....|.|.....:  :|.|.|.  ||.::||:...:      ..:||: .:.||
Human   458 FQSISSDSLHSINNLQSSLKTSKILEHLKEDSSEASSQEEDVLQHAIIHKKHTGKSPIVNNIGTS 522

  Fly   360 ----DG---------------EQTCTSSQLFHEENAMDATD----VKMGLSCITEPEGTSVVASS 401
                ||               :|:||:.|  |.|:.:.:.|    .|..||.|.:.:|..     
Human   523 CSPLDGLTMQYSEQNGIVDWRKQSCTTIQ--HPEHCVTSADQHSAEKRSLSSINKKKGKP----- 580

  Fly   402 TTPPMHSPSCSVMSSDDFIVQKDTTRLLTECENANDEDLLVLTETAIREAIGEEPKDKEVVENAS 466
                         .::...::|...||     |:....:.:.|.   :.|.|...||    .|..
Human   581 -------------QTEKEKIKKTDNRL-----NSRINGIRLSTP---QHAHGGTVKD----VNLD 620

  Fly   467 EEQEHDHAADTSSEYEFVPPSRLEEIKKNYRVDDQQFRALDVYESESD------LTESGIYSKAK 525
            ....||...:||||....|.|...:.::::..::::.|..|....:|.      .|..|..::..
Human   621 IGSGHDTCGETSSESYSSPSSPRHDGRESFESEEEKDRDTDSNSEDSGNPSTTRFTGYGSVNQTV 685

  Fly   526 SKTTPTIIRNVDSSSGSSSVEEVVEPSVQKTKRLRKRSCSTNNHSQSD------PNNDDG 579
            :...|..|.::.:.:|:...:.:..|..|....:....|..:|.:|..      |...||
Human   686 TVKPPVQIASLGNENGNLLEDPLNSPKYQHISFMPTLHCVMHNGAQKSEVVVPAPKPADG 745

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Zcchc7NP_648926.3 PTZ00368 827..937 CDD:173561
ZCCHC2NP_060212.4 PX_domain 363..461 CDD:295365 21/122 (17%)
zf-CCHC 1133..1148 CDD:278525
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.