DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Zcchc7 and glh-4

Sequence 1:NP_648926.3 Gene:Zcchc7 FlyBaseID:FBgn0036668 Length:1734 Species:Drosophila melanogaster
Sequence 2:NP_491207.3 Gene:glh-4 WormBaseID:WBGene00001601 Length:1156 Species:Caenorhabditis elegans

Alignment Length:679 Identity:146/680 (21%)
Similarity:219/680 (32%) Gaps:233/680 (34%)


  Fly   846 RPRSHAKCSNCFEMGHVRSKCPRPRKP-LVCFICGTMGH-----AEPRCPNAICFGCGSKQEIYV 904
            |||.   |.||.|.||:..:|.:|:.| ..|..|..:||     .:||.|...|..||.:....|
 Worm   568 RPRG---CHNCGEEGHISKECDKPKVPRFPCRNCEQLGHFASDCDQPRVPRGPCRNCGIEGHFAV 629

  Fly   905 QQCNKCSFHSRLVCQLCKMRGHGVDHCPDKWRRYHSTTRSNTELDSRVQYRSVQCSYCA--GRHS 967
             .|::... .|..|:.|...||....|.::..|...|.               .|..||  |...
 Worm   630 -DCDQPKV-PRGPCRNCGQEGHFAKDCQNERVRMEPTE---------------PCRRCAEEGHWG 677

  Fly   968 FENCRQRIGDFR--------------------STNYTSQIVSHQKIYKNRGGPIGNLGDLKSF-- 1010
            :| |..|..|.:                    :.|...:|...||:..:.|..  .:.|:.||  
 Worm   678 YE-CPTRPKDLQGNFLESYDFVFTPDDKMFEDAVNNDDKIDFDQKVVASTGKV--EIPDMASFDG 739

  Fly  1011 FAIETPFHFKWNNPSMPKNCYYSRFLVNANLAKVQSVKRKSTTAVSQIPEKIYTHEYVP----NA 1071
            |.|            :|::       ::.||.:::..:          |..|....:.|    |.
 Worm   740 FKI------------LPQD-------LHDNLKRMKMNR----------PTPIQRASFFPIMHGND 775

  Fly  1072 QVKAARGEVSTGTAKKPLTKQMPVVESIAENRTAEEPIGKLNREDEKSKDILPLPEVPPEVKQTQ 1136
            .|..|.    ||:. |.|...:|.|.             ||..|.||.:|:             .
 Worm   776 VVACAH----TGSG-KTLAFLIPFVI-------------KLMEEFEKDRDV-------------T 809

  Fly  1137 DEKLVEGQPNQSQPDEELPMKDDDQEEPSSSVQREEITTNFDNPPTEPGLSRTPLAPHELDSDSN 1201
            |||          |...|.:     ..|:..:..:..|| ......|.|| :..||......::|
 Worm   810 DEK----------PSPRLLI-----VAPTRELVNQTFTT-ARQLTYETGL-KCGLAFGGYSRNAN 857

  Fly  1202 YSFSEHFELPSSTTSDGQPNTQLP-LVRTMGTLPD-------------VIPLSKDDFELSSNVQG 1252
            ......|             :||. ||.|||.|.|             .|.|.:.|..:.||..|
 Worm   858 VQHLRSF-------------SQLNILVATMGRLQDFVNAGEVSLSKMKYIVLDEADRMVDSNDFG 909

  Fly  1253 ISMCVNSSSTSLRTDETP--DPDSSEEL--PDVPSEGKIIMAREESEYLFSAEGRTFL-----AA 1308
            ..:.....|...||.:|.  ....||:|  .|:|.              |..||.|.|     ..
 Worm   910 EEVSKIIGSPGERTQQTVLFSASFSEDLQSDDLPK--------------FVKEGYTMLQVDKFGT 960

  Fly  1309 AAKQCHVSV----RMDFKDYGYVLVIYGLKKHQEELQVKLLRRSQEVKRKSIEFQSQKPPKRIDV 1369
            |.::....:    |.:.:|..|.|:  |:    :|..|.||..:...|:|::.|.:.  .|..|.
 Worm   961 ANEKIDQKILPVPRTEKRDAIYKLL--GI----DENTVTLLPDAPIEKQKTLIFVNS--VKFCDT 1017

  Fly  1370 LIRFLRD-GINSLNTN------------------------LGNAKSHYVRIKELE-----GMNTK 1404
            |...:.. |:::::.:                        ..|..:..:.|..|:     .|..|
 Worm  1018 LAALISSAGVSTISMHSYQNQEQRDRTLDDFRRGKYQCMVASNVCARGLNIAGLDHVVNYDMPDK 1082

  Fly  1405 NGFKMAEKKRRQLNMI-LVGQAGLLNGKT 1432
            |||.      ..:|.| ..|:||.....|
 Worm  1083 NGFD------EYVNRIGRTGRAGFTGTST 1105

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Zcchc7NP_648926.3 PTZ00368 827..937 CDD:173561 30/97 (31%)
glh-4NP_491207.3 zf-CCHC 570..587 CDD:278525 8/20 (40%)
PTZ00368 572..685 CDD:173561 36/131 (27%)
zf-CCHC 616..633 CDD:278525 5/18 (28%)
zf-CCHC 639..656 CDD:278525 5/17 (29%)
P-loop_NTPase 743..938 CDD:304359 58/273 (21%)
DEXDc 751..968 CDD:214692 64/302 (21%)
HELICc 964..1104 CDD:238034 29/154 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001592
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.