DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Zcchc7 and LOC105945821

Sequence 1:NP_648926.3 Gene:Zcchc7 FlyBaseID:FBgn0036668 Length:1734 Species:Drosophila melanogaster
Sequence 2:XP_017945803.1 Gene:LOC105945821 ID: Length:428 Species:Xenopus tropicalis

Alignment Length:225 Identity:47/226 (21%)
Similarity:69/226 (31%) Gaps:58/226 (26%)


  Fly   732 ISDEEDSRDKSADTTVRSDEDIDASNDLEETNPDKNDRDVTNEEQHVHVEH--NLQEL------- 787
            ::|.|:.||..||...:..|.|.....::|.   :|.|   .|...|....  ..|:.       
 Frog   136 MNDTEERRDWLADLVYQELELIKEYGSIQEL---ENQR---KEALRVCAPSFCGFQQAQPCLGTV 194

  Fly   788 --RDESLPKSGDLIGWNEEMRSFYND-SWNGENFSV---------HKVQRMMTGHRHEWRINTAD 840
              :|..||.|....|..||.::.... .|:.....|         ..:....:|..|...:..|:
 Frog   195 GPKDFHLPPSTVSAGVGEEQKASQTTLFWSPSEIPVCTEFSGCVAPVLAEPESGRCHFKGLAEAE 259

  Fly   841 RCPVARPRSHAK-CSNCFEMGHVRSKCPRPRKPLVCFICGTMGHAEPRCPNAICFGCGSKQEIYV 904
            ..|...|..... |..|.:.|||...|      ::|..||..||                     
 Frog   260 ASPSENPVGMPDFCKRCRQYGHVTDGC------VLCPNCGKEGH--------------------- 297

  Fly   905 QQCNKCSFHSRLVCQLCKMRGHGVDHCPDK 934
             :...||...:  |..|...||....||.:
 Frog   298 -EVVNCSLSRK--CHFCLQEGHLYSKCPQR 324

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Zcchc7NP_648926.3 PTZ00368 827..937 CDD:173561 24/110 (22%)
LOC105945821XP_017945803.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001592
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.