DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9701 and BGLU40

Sequence 1:NP_648918.1 Gene:CG9701 FlyBaseID:FBgn0036659 Length:541 Species:Drosophila melanogaster
Sequence 2:NP_173978.1 Gene:BGLU40 AraportID:AT1G26560 Length:510 Species:Arabidopsis thaliana

Alignment Length:527 Identity:196/528 (37%)
Similarity:287/528 (54%) Gaps:63/528 (12%)


  Fly     1 MMQIILPLFVLTASCLGSPVSQTRRFPNDFLWGVGSSSYQIEGGWNADDKGESIWDFLTHTHPEK 65
            ||.::..:.::..:|:.:.:|: ..||..|::|..||::|.||...|:.:|.:|||..:||. .|
plant    13 MMMMVTMMMMMDKTCICADISR-GSFPKGFVFGTASSAFQHEGAVKAEGRGPTIWDTFSHTF-GK 75

  Fly    66 IVDRSNGDVSADSYHQWKRDVQMVKELHVGTYRFSLSWPRIMPGGYMNHVSTAGIKYYSNLIDEL 130
            |.|.||.||:.|.||:::.|||::|.:.:..||||:||.||.|.| :.|::.|||.:|:.||:.|
plant    76 ITDFSNADVAVDQYHRYEEDVQLMKNMGMDAYRFSISWTRIFPNG-VGHINEAGIDHYNKLINAL 139

  Fly   131 LRYNITPMVTIYHWELPQKLQE-LGGWTNPEIIPLFKDYARLVLEMYGDRVKIWTTVNEPWHVCE 194
            |...|.|.||:|||:|||.|.: ..||.||:||..|..||.:..:.:|||||.|.|.|||.....
plant   140 LAKGIEPYVTLYHWDLPQALHDRYLGWLNPQIINDFAAYAEVCFQRFGDRVKHWITFNEPHTFAI 204

  Fly   195 HGYGVDYMAP---------------SYNYPGIPAYLCGHNLLKAHAEVVHMYRELFQPRQGGRMG 244
            .||.|...||               |...|    |:.|||::..||.|..:||:.::.:|||.:|
plant   205 QGYDVGLQAPGRCTILFKLTCREGNSSTEP----YIVGHNVILTHATVSDIYRKKYKAKQGGSLG 265

  Fly   245 ITLDTSWPEPRDPNSAEDREASERAMQFYVGWFGHPIFSKHGNYPKVMIERIRNLSKEQGFGARS 309
            |..|..|.|| :.|..||.||::||..|.:|||..|:.  .|:||..|..|:           .|
plant   266 IAFDVMWFEP-ESNKTEDIEAAQRAQDFQLGWFLDPLM--FGDYPSSMRSRV-----------GS 316

  Fly   310 RLPEFTTEEIHRIRGTSDFFGINSYTSNLVTSNGHNNTGKFPVPSFNHDMGVVESQEGVDWPGSG 374
            |||.||..:...::|:.||.|||.||:....:|..|..|     :..||  .|.....|..|..|
plant   317 RLPVFTGSQSSLVKGSLDFVGINHYTTYYARNNATNLIG-----TLLHD--AVSDSGTVTLPFKG 374

  Fly   375 ---------SVWLKVYPKGMYNLLMWIHREYNAPEIIVTENGVSD--------RGGLEDYARVDY 422
                     |:||.:.|:||.:|:.:|...|..|.:.:||||:.|        :..|:|..|:.|
plant   375 LSTIGDRASSIWLYIVPRGMRSLMNYIKHRYGNPPVFITENGMDDPNSILISRKDALKDAKRIKY 439

  Fly   423 YNLYLSAVLDAM-EDGANISGYIAWSLMDSYEWKAGFSEKFGLYHVDFNSPQRTRTPKISARVFA 486
            ::.|||::..:: |||.|:.||..|||:|::||.||:|.:||||.||:....: |.||.|...|.
plant   440 HHDYLSSLQASIKEDGCNVKGYFVWSLLDNWEWAAGYSSRFGLYFVDYRDNLK-RYPKDSVHWFT 503

  Fly   487 QLCKTNT 493
            ....:.:
plant   504 SFLNSTS 510

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9701NP_648918.1 Glyco_hydro_1 22..492 CDD:304882 192/504 (38%)
BGLU40NP_173978.1 Glyco_hydro_1 33..505 CDD:304882 193/501 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 357 1.000 Inparanoid score I588
OMA 1 1.010
OrthoDB 1 1.010 D408001at2759
OrthoInspector 1 1.000 T124207
orthoMCL 1 0.900 OOG5_126690
Panther 1 1.100 O PTHR10353
Phylome 1 0.910 0.600 Consistency score
87.980

Return to query results.
Submit another query.