DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9701 and BGLU42

Sequence 1:NP_648918.1 Gene:CG9701 FlyBaseID:FBgn0036659 Length:541 Species:Drosophila melanogaster
Sequence 2:NP_198505.2 Gene:BGLU42 AraportID:AT5G36890 Length:490 Species:Arabidopsis thaliana

Alignment Length:487 Identity:199/488 (41%)
Similarity:283/488 (58%) Gaps:35/488 (7%)


  Fly    19 PVSQTRRFPNDFLWGVGSSSYQIEGGWNADDKGESIWDFLTHTHPEKIVDRSNGDVSADSYHQWK 83
            ||:....||:.|.:||.:|:||||||||...||.||||..||.. .||:|.|||||:.|.||::|
plant    14 PVTHRSNFPSTFTFGVATSAYQIEGGWNEGKKGPSIWDKFTHIE-GKILDGSNGDVAVDHYHRYK 77

  Fly    84 RDVQMVKELHVGTYRFSLSWPRIMPGGYMNHVSTAGIKYYSNLIDELLRYNITPMVTIYHWELPQ 148
            .||.::.:|..|.||||:||.||.|.|....|:..||.:|::||:.||...|.|.||:|||:||.
plant    78 EDVDLIGQLGFGAYRFSISWSRIFPDGLGTEVNEEGIAFYNDLINTLLEKGIQPYVTLYHWDLPS 142

  Fly   149 KLQE-LGGWTNPEIIPLFKDYARLVLEMYGDRVKIWTTVNEPWHVCEHGYGVDYMAPSYN-YPGI 211
            .||| :|||||.:|:..|..||......:|||||.|.|:|||.....:|:.:...||..| .|.|
plant   143 HLQEAIGGWTNRKIVDYFGLYADACFANFGDRVKHWITLNEPLQTSVNGHCIGIFAPGRNEKPLI 207

  Fly   212 PAYLCGHNLLKAHAEVVHMYRELFQPRQGGRMGITLDTSWPEPRDPNSAEDREASERAMQFYVGW 276
            ..||..|:.:.|||..|.:||..::..|||::|:::|..|.|| :....||:.|::|.:.|.:||
plant   208 EPYLVSHHQVLAHATAVSIYRSKYKESQGGQIGLSVDCEWAEP-NSEKPEDKVAADRRIDFQLGW 271

  Fly   277 FGHPIFSKHGNYPKVMIERIRNLSKEQGFGARSRLPEFTTEEIH-RIRGTSDFFGINSYTSNLVT 340
            |..|:|  .|:||..|.:::.:           .||.||.||.. .::.:.||.|:|.|||.|::
plant   272 FLDPLF--FGDYPASMRQKLGD-----------NLPRFTPEEKEFMLQNSWDFLGLNHYTSRLIS 323

  Fly   341 --SNGHNNTGKFPVPSFNHDMGVVESQEGVDWPG--SGSVWLKVYPKGMYNLLMWIHREYNAPEI 401
              ||....:..:.......   :||.:.| |..|  :.|.||...|.|:...|.::.::||.|.|
plant   324 HVSNKEAESNFYQAQELER---IVELENG-DLIGERAASDWLYAVPWGIRKTLNYMSKKYNHPPI 384

  Fly   402 IVTENGVSDRGG--------LEDYARVDYYNLYLSAVLDAMEDGANISGYIAWSLMDSYEWKAGF 458
            .:||||:.|...        |:|..||||:..||:.|..|:|||.:|.||.||||:|::||..|:
plant   385 FITENGMDDEDDGSASIHDMLDDKRRVDYFKSYLANVSQAIEDGVDIKGYFAWSLLDNFEWAQGY 449

  Fly   459 SEKFGLYHVDFNSPQRTRTPKISARVFAQLCK 490
            :::|||.:||:.: ..||.||.||..|.:..|
plant   450 TKRFGLVYVDYKN-GLTRHPKSSAYWFMKFLK 480

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9701NP_648918.1 Glyco_hydro_1 22..492 CDD:304882 197/485 (41%)
BGLU42NP_198505.2 Glyco_hydro_1 17..475 CDD:304882 195/478 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H75140
Inparanoid 1 1.050 357 1.000 Inparanoid score I588
OMA 1 1.010
OrthoDB 1 1.010 D408001at2759
OrthoInspector 1 1.000 T124207
orthoMCL 1 0.900 OOG5_126690
Panther 1 1.100 O PTHR10353
Phylome 1 0.910 0.600 Consistency score
98.980

Return to query results.
Submit another query.