DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9701 and BGLU16

Sequence 1:NP_648918.1 Gene:CG9701 FlyBaseID:FBgn0036659 Length:541 Species:Drosophila melanogaster
Sequence 2:NP_191572.1 Gene:BGLU16 AraportID:AT3G60130 Length:514 Species:Arabidopsis thaliana

Alignment Length:515 Identity:199/516 (39%)
Similarity:285/516 (55%) Gaps:54/516 (10%)


  Fly     8 LFVLTASCLG------SPVSQTRR--FPNDFLWGVGSSSYQIEGGWNADDKGESIWDFLTHTHPE 64
            |.::|.:|:|      |...:.||  ||.||::|..:|:||.||..:.|.:|.||||..:...||
plant     9 LLLITLACIGVSAKKHSTRPRLRRNDFPQDFVFGSATSAYQCEGAAHEDGRGPSIWDSFSEKFPE 73

  Fly    65 KIVDRSNGDVSADSYHQWKRDVQMVKELHVGTYRFSLSWPRIMPGGYM-NHVSTAGIKYYSNLID 128
            ||:|.|||.::.|||:.:|.||.::.::....||||:||.||:|.|.: ..::.|||:||:|||:
plant    74 KIMDGSNGSIADDSYNLYKEDVNLLHQIGFDAYRFSISWSRILPRGTLKGGINQAGIEYYNNLIN 138

  Fly   129 ELLRYNITPMVTIYHWELPQKLQE-LGGWTNPEIIPLFKDYARLVLEMYGDRVKIWTTVNEPWHV 192
            :|:...:.|.||::||:||..|:. .||....|.:..|:|||.|..:.:|||||.|||:|||:.:
plant   139 QLISKGVKPFVTLFHWDLPDALENAYGGLLGDEFVNDFRDYAELCFQKFGDRVKQWTTLNEPYTM 203

  Fly   193 CEHGYGVDYMAP----SYNYP-------GIPAYLCGHNLLKAHAEVVHMYRELFQPRQGGRMGIT 246
            ...||.....||    ::..|       ....|:.|||||.||...|.:|||.:|..|.|.:||.
plant   204 VHEGYITGQKAPGRCSNFYKPDCLGGDAATEPYIVGHNLLLAHGVAVKVYREKYQATQKGEIGIA 268

  Fly   247 LDTSWPEPRDPNSAEDREASERAMQFYVGWFGHPIFSKHGNYPKVMIERIRNLSKEQGFGARSRL 311
            |:|:|..|.. :|..||.|:.||..|...:|..||.  :|.||..|:..:::          .||
plant   269 LNTAWHYPYS-DSYADRLAATRATAFTFDYFMEPIV--YGRYPIEMVSHVKD----------GRL 320

  Fly   312 PEFTTEEIHRIRGTSDFFGINSYTSNLVTSNGHNNTGKFPVPSFNHDM------GVVESQEGVD- 369
            |.||.||...::|:.||.|:|.|:|.....        .|..:.|..|      .:|..:.||. 
plant   321 PTFTPEESEMLKGSYDFIGVNYYSSLYAKD--------VPCATENITMTTDSCVSLVGERNGVPI 377

  Fly   370 WPGSGSVWLKVYPKGMYNLLMWIHREYNAPEIIVTENGVSDRG----GLEDYARVDYYNLYLSAV 430
            .|.:||.||.:||||:.:||:.....||.|.:.:|||||.:..    .|.|..|:|||..:|..|
plant   378 GPAAGSDWLLIYPKGIRDLLLHAKFRYNDPVLYITENGVDEANIGKIFLNDDLRIDYYAHHLKMV 442

  Fly   431 LDAMEDGANISGYIAWSLMDSYEWKAGFSEKFGLYHVDFNSPQRTRTPKISARVFAQLCK 490
            .||:..|.|:.||.||||||::||..|::.:|||..|||.. .|.|..|.||:.|.:|.|
plant   443 SDAISIGVNVKGYFAWSLMDNFEWSEGYTVRFGLVFVDFED-GRKRYLKKSAKWFRRLLK 501

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9701NP_648918.1 Glyco_hydro_1 22..492 CDD:304882 194/496 (39%)
BGLU16NP_191572.1 Glyco_hydro_1 32..501 CDD:304882 192/491 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 357 1.000 Inparanoid score I588
OMA 1 1.010
OrthoDB 1 1.010 D408001at2759
OrthoInspector 1 1.000 T124207
orthoMCL 1 0.900 OOG5_126690
Panther 1 1.100 O PTHR10353
Phylome 1 0.910 0.600 Consistency score
87.980

Return to query results.
Submit another query.