DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9701 and BGLU25

Sequence 1:NP_648918.1 Gene:CG9701 FlyBaseID:FBgn0036659 Length:541 Species:Drosophila melanogaster
Sequence 2:NP_187014.1 Gene:BGLU25 AraportID:AT3G03640 Length:531 Species:Arabidopsis thaliana

Alignment Length:539 Identity:188/540 (35%)
Similarity:276/540 (51%) Gaps:55/540 (10%)


  Fly     1 MMQIILPLFVL-TASCLGSPVSQTRRFPNDFLWGVGSSSYQIEGGWNADDKGESIWDFLTHTHPE 64
            ::.|:.|:.|. .|.|..|.......||:.||:|..:|::|.||......:|.||||..|.....
plant    13 LVVIVSPITVYGGAVCPASSTFGRGSFPDGFLFGATTSAFQHEGAAEEGGRGSSIWDSFTLKQHS 77

  Fly    65 KIVDRSNGDVSADSYHQWKRDVQMVKELHVGTYRFSLSWPRIMPGGYMNH-VSTAGIKYYSNLID 128
            :..:..:|.:..|.||.:|.|||::|:|::..:|||:||.||.|.|..:. ||..|:|:|::||:
plant    78 ESNNNLDGRLGVDFYHHYKEDVQLLKKLNMDAFRFSISWSRIFPHGKKDKGVSETGVKFYNDLIN 142

  Fly   129 ELLRYNITPMVTIYHWELPQKLQ-ELGGWTNPEIIPLFKDYARLVLEMYGDRVKIWTTVNEPWHV 192
            ||:...:||:||::.|::||.|: |.||:.:..|:..|:|:|:.....||||||.|.|:|||:..
plant   143 ELIANGVTPLVTLFQWDVPQALEDEYGGFLSDRILEDFRDFAQFAFNKYGDRVKHWVTINEPYEF 207

  Fly   193 CEHGYGVDYMAPS-----------YNYPGIPAYLCGHNLLKAHAEVVHMYRELFQPRQGGRMGIT 246
            ...||.....||.           ....|...|...||||.||||.|..:|:..: ..||::||.
plant   208 SRGGYETGEKAPGRCSKYVNEKCVAGKSGHEVYTVSHNLLLAHAEAVEEFRKCGK-CTGGKIGIV 271

  Fly   247 LDTSWPEPRD--PNSAEDREASERAMQFYVGWFGHPIFSKHGNYPKVMIERIRNLSKEQGFGARS 309
            ....|.||.|  ..|:...|..:|||.|.:||...||  .||:||:.|.:.:           .|
plant   272 QSPMWFEPYDKKSTSSPSEEIVKRAMDFTLGWHMEPI--THGDYPQAMKDVV-----------GS 323

  Fly   310 RLPEFTTEEIHRIRGTSDFFGINSYTSNLVTSNGHNNTGKFPVPSFNHDMGVVESQEGVDW--PG 372
            |||.||.|:..:::|:.||.|||.:||..|....:.|..|   ||:..|..:......||.  .|
plant   324 RLPSFTPEQKEKLKGSYDFVGINYFTSTFVAHTDNVNPEK---PSWEADSRLQLHSNNVDGFKIG 385

  Fly   373 SGSVWLKVYP---KGMYNLLMWIHREYNAPEIIVTENGVSDR--------GGLEDYARVDYYNLY 426
            |.....| ||   .|:..:|.:|...||.||||||.||..:.        ..|.|..|..|:..:
plant   386 SQPATAK-YPVCADGLRKVLKYIKENYNDPEIIVTGNGYKETLEEKDVLPDALSDSNRKYYHMRH 449

  Fly   427 LSAVLDAM-EDGANISGYIAWSLMDSYEWKAGFSEKFGLYHVDFNSPQRTRTPKISARVFAQLCK 490
            |.|:..|: ||..|:.||...||||..||:.|:..:.|||:||:.. ...|..|.||:..::|.:
plant   450 LMALHGAVCEDKVNVKGYFVSSLMDGLEWEDGYKTRSGLYYVDYGH-NMGRHEKQSAKWLSKLLE 513

  Fly   491 --TNTIDWSYRPKLDEEQQ 507
              .:||    :.|:|.:.:
plant   514 KVPDTI----QSKVDSDSR 528

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9701NP_648918.1 Glyco_hydro_1 22..492 CDD:304882 178/501 (36%)
BGLU25NP_187014.1 Glyco_hydro_1 36..514 CDD:304882 178/497 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D408001at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10353
Phylome 1 0.910 0.600 Consistency score
44.020

Return to query results.
Submit another query.