DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9701 and PYK10

Sequence 1:NP_648918.1 Gene:CG9701 FlyBaseID:FBgn0036659 Length:541 Species:Drosophila melanogaster
Sequence 2:NP_187537.1 Gene:PYK10 AraportID:AT3G09260 Length:524 Species:Arabidopsis thaliana

Alignment Length:537 Identity:188/538 (35%)
Similarity:289/538 (54%) Gaps:61/538 (11%)


  Fly     5 ILPLFVLTAS--------CLGSPVSQTRRFPNDFLWGVGSSSYQIEGGWNADDKGESIWDFLTHT 61
            :|.|..:.||        |..|.......||..||:|..:::||:||..|...:|.::||.....
plant    11 LLLLLTIVASPANADGPVCPPSNKLSRASFPEGFLFGTATAAYQVEGAINETCRGPALWDIYCRR 75

  Fly    62 HPEKIVDRSNGDVSADSYHQWKRDVQMVKELHVGTYRFSLSWPRIMPGGYMNH-VSTAGIKYYSN 125
            :||: .:..||||:.|.:|::|.|:|::|.|:...:|.|::||||.|.|.... ||.||:::|.:
plant    76 YPER-CNNDNGDVAVDFFHRYKEDIQLMKNLNTDAFRMSIAWPRIFPHGRKEKGVSQAGVQFYHD 139

  Fly   126 LIDELLRYNITPMVTIYHWELPQKLQ-ELGGWTNPEIIPLFKDYARLVLEMYGDRVKIWTTVNEP 189
            |||||::..|||.||::||:.||.|: |.||:.:..|:..|::||..|.:.||.:||.|.|.|||
plant   140 LIDELIKNGITPFVTVFHWDTPQDLEDEYGGFLSERIVKDFREYADFVFQEYGGKVKHWITFNEP 204

  Fly   190 WHVCEHGYGVDYMAP----SY-------NYPGIPAYLCGHNLLKAHAEVVHMYRELFQPRQGGRM 243
            |.....||.|...||    ||       ...|..|||..||||.:|||.|..||:. :..:||::
plant   205 WVFSHAGYDVGKKAPGRCSSYVNAKCQDGRSGYEAYLVTHNLLISHAEAVEAYRKC-EKCKGGKI 268

  Fly   244 GITLDTSWPEPRDPNSAEDREASERAMQFYVGWFGHPIFSKHGNYPKVMIERIRNLSKEQGFGAR 308
            ||....:|.|..|...::|..:.:||:.|.:||  |...:..|:||::|.:.:.:          
plant   269 GIAHSPAWFEAHDLADSQDGASIDRALDFILGW--HLDTTTFGDYPQIMKDIVGH---------- 321

  Fly   309 SRLPEFTTEEIHRIRGTSDFFGINSYTSNLVTSNGHNNTGKFPVPSFNHDMGVV-ESQEGVDWP- 371
             |||:||||:..:::.::||.|:|.|||  |.|| |........|.:..|..:. ||:...::. 
plant   322 -RLPKFTTEQKAKLKASTDFVGLNYYTS--VFSN-HLEKPDPSKPRWMQDSLITWESKNAQNYAI 382

  Fly   372 GSG--SVWLKVYPKGMYNLLMWIHREYNAPEIIVTENGVSDR--------GGLEDYARVDYYNLY 426
            ||.  :..|.||.:|..:||.:|..:|..|||::.|||..:.        .|..|:.|..|...:
plant   383 GSKPLTAALNVYSRGFRSLLKYIKDKYANPEIMIMENGYGEELGASDSVAVGTADHNRKYYLQRH 447

  Fly   427 LSAVLDAM-EDGANISGYIAWSLMDSYEWKAGFSEKFGLYHVDFNSPQRTRTPKISARVFAQLCK 490
            |.::.:|: .|..|::||..|||:|::||:.|:..:||||:|||.: ..||..|.|.:.:...  
plant   448 LLSMQEAVCIDKVNVTGYFVWSLLDNFEWQDGYKNRFGLYYVDFKN-NLTRYEKESGKYYKDF-- 509

  Fly   491 TNTIDWSYRP---KLDE 504
               :....||   |.||
plant   510 ---LSQGVRPSALKKDE 523

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9701NP_648918.1 Glyco_hydro_1 22..492 CDD:304882 177/496 (36%)
PYK10NP_187537.1 Glyco_hydro_1 36..511 CDD:304882 177/499 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D408001at2759
OrthoInspector 1 1.000 T124207
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10353
Phylome 1 0.910 0.600 Consistency score
66.030

Return to query results.
Submit another query.