DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9701 and BGLU29

Sequence 1:NP_648918.1 Gene:CG9701 FlyBaseID:FBgn0036659 Length:541 Species:Drosophila melanogaster
Sequence 2:NP_001118524.1 Gene:BGLU29 AraportID:AT2G44470 Length:590 Species:Arabidopsis thaliana

Alignment Length:549 Identity:183/550 (33%)
Similarity:291/550 (53%) Gaps:81/550 (15%)


  Fly     2 MQIILPLFV---LTASCLGSP----VSQTRRFPNDFLWGVGSSSYQIEGGWNADDKGESIWDFLT 59
            :||.:.|.:   ||......|    |.....||:||::|...|::|.||..:...|..:|||:.:
plant     3 VQIFILLLIISWLTPKITSLPPESQVLDRSSFPDDFVFGTAISAFQSEGATSEGGKSPTIWDYFS 67

  Fly    60 HTHPEKIVDRSNGDVSADSYHQWKRDVQMVKELHVGTYRFSLSWPRIMPGGYM-NHVSTAGIKYY 123
            ||.||: .:..|.||:.|.||::|.|:::::||:|..:|||:||.|::|.|.: :.|:..|:::|
plant    68 HTFPER-TNMQNADVAVDFYHRYKDDIKLIEELNVDAFRFSISWARLIPSGKVKDGVNKEGVQFY 131

  Fly   124 SNLIDELLRYNITPMVTIYHWELPQKLQ-ELGGWTNPEIIPLFKDYARLVLEMYGDRVKIWTTVN 187
            ..|||||:...|.|.||:|||:.||.|: |.||:.||:||..|:::||:..|.:||:||:|||:|
plant   132 KALIDELIANGIQPSVTLYHWDHPQALEDEYGGFLNPQIIEDFRNFARVCFENFGDKVKMWTTIN 196

  Fly   188 EPWHVCEHGY--GVDYMAPSYNY---------PGIPAYLCGHNLLKAHAEVVHMYRELFQPRQGG 241
            ||:.:...||  |:..:.....:         ..|..|:..|:||.:||..|..:|...:..|.|
plant   197 EPYVISVAGYDTGIKAVGRCSKWVNSRCQAGDSAIEPYIVSHHLLLSHAAAVQEFRNCNKTLQDG 261

  Fly   242 RMGITLDTSWPEPRDPNSAEDREASERAMQFYVGWFGHPIFSKHGNYPKVMIERIRNLSKEQGFG 306
            ::||.:...|.||.|..|:.|:||.||.:...:.|..:|:.  :|:||:.|.:.:.|        
plant   262 KIGIVISPWWLEPYDSTSSADKEAVERGLPLELEWHLNPVI--YGDYPETMKKHVGN-------- 316

  Fly   307 ARSRLPEFTTEEIHRIRGTSDFFGINSYTSNLVTSNGHNNTGKFPVPSF--------------NH 357
               |||.||.|:...:..:|||.|:|.|:.:......|.:..:   |.|              ||
plant   317 ---RLPAFTPEQSKMLINSSDFIGVNYYSIHFTAHLPHIDHTR---PRFRTDHHFEKKLINRSNH 375

  Fly   358 DMGVVESQEGVDWPGSGSVWLKVYPKGMYNLLMWIHREYNAPEIIVTENGVS--DRGG------L 414
            :.|          ||.....:..:|:|:..:|.:|..:||.|.:.|.|||:.  |.|.      |
plant   376 ETG----------PGDDRGKIHSHPEGLRRVLNYIKDKYNNPIVYVKENGIDHYDDGTKSRETIL 430

  Fly   415 EDYARVDYYNLYLSAVLDA-MEDGANISGYIAWSLMDSYEWKAGFSEKFGLYHVDF-NSPQRTRT 477
            :|..|:.|:..:|..|..| :|||.::.||..|||.|::||:.|::.:||:|:||| |:.|  |.
plant   431 KDTFRISYHQDHLKQVHKAIIEDGCDVRGYYVWSLFDNFEWEHGYNSRFGMYYVDFKNNLQ--RY 493

  Fly   478 PKISARVFAQLCKTNTIDWSYRPKLDEEQ 506
            ||.|...|.:...        ||.:..|:
plant   494 PKDSVNWFKKFLS--------RPVVRSEE 514

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9701NP_648918.1 Glyco_hydro_1 22..492 CDD:304882 173/507 (34%)
BGLU29NP_001118524.1 Glyco_hydro_1 31..507 CDD:304882 173/513 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 357 1.000 Inparanoid score I588
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D408001at2759
OrthoInspector 1 1.000 T124207
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10353
Phylome 1 0.910 0.600 Consistency score
66.070

Return to query results.
Submit another query.